Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08913
Secondary Accession Numbers
  • 14642
Name Dual specificity protein phosphatase 6
Synonyms
  1. Dual specificity protein phosphatase PYST1
  2. MAP kinase phosphatase 3
  3. MKP-3
  4. Mitogen-activated protein kinase phosphatase 3
Gene Name DUSP6
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function Inactivates MAP kinases. Has a specificity for the ERK family.
Pathways
  • MAPK signaling pathway
  • Transcriptional misregulation in cancer
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
A phosphoprotein + Water → a protein + Phosphate details
GO Classification
Biological Process
positive regulation of apoptotic process
response to nitrosative stress
response to drug
innate immune response
cell differentiation
response to organic cyclic compound
MyD88-dependent toll-like receptor signaling pathway
negative regulation of ERK1 and ERK2 cascade
stress-activated MAPK cascade
Toll signaling pathway
toll-like receptor 1 signaling pathway
toll-like receptor 2 signaling pathway
toll-like receptor 3 signaling pathway
toll-like receptor 4 signaling pathway
TRIF-dependent toll-like receptor signaling pathway
dorsal/ventral pattern formation
regulation of endodermal cell fate specification
regulation of fibroblast growth factor receptor signaling pathway
regulation of heart growth
response to growth factor stimulus
nerve growth factor receptor signaling pathway
peptidyl-tyrosine dephosphorylation
Cellular Component
cytosol
nucleoplasm
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
map kinase tyrosine/serine/threonine phosphatase activity
protein tyrosine/serine/threonine phosphatase activity
Molecular Function
MAP kinase tyrosine/serine/threonine phosphatase activity
protein tyrosine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location 12
Locus 12q22-q23
SNPs DUSP6
Gene Sequence
>1146 bp
ATGATAGATACGCTCAGACCCGTGCCCTTCGCGTCGGAAATGGCGATCAGCAAGACGGTG
GCGTGGCTCAACGAGCAGCTGGAGCTGGGCAACGAGCGGCTGCTGCTGATGGACTGCCGG
CCGCAGGAGCTATACGAGTCGTCGCACATCGAGTCGGCCATCAACGTGGCCATCCCGGGC
ATCATGCTGCGGCGCCTGCAGAAGGGTAACCTGCCGGTGCGCGCGCTCTTCACGCGCGGC
GAGGACCGGGACCGCTTCACCCGGCGCTGTGGCACCGACACAGTGGTGCTCTACGACGAG
AGCAGCAGCGACTGGAACGAGAATACGGGCGGCGAGTCGTTGCTCGGGCTGCTGCTCAAG
AAGCTCAAGGACGAGGGCTGCCGGGCGTTCTACCTGGAAGGTGGCTTCAGTAAGTTCCAA
GCCGAGTTCTCCCTGCATTGCGAGACCAATCTAGACGGCTCGTGTAGCAGCAGCTCGCCG
CCGTTGCCAGTGCTGGGGCTCGGGGGCCTGCGGATCAGCTCTGACTCTTCCTCGGACATC
GAGTCTGACCTTGACCGAGACCCCAATAGTGCAACAGACTCGGATGGTAGTCCGCTGTCC
AACAGCCAGCCTTCCTTCCCAGTGGAGATCTTGCCCTTCCTCTACTTGGGCTGTGCCAAA
GACTCCACCAACTTGGACGTGTTGGAGGAATTCGGCATCAAGTACATCTTGAACGTCACC
CCCAATTTGCCGAATCTCTTTGAGAACGCAGGAGAGTTTAAATACAAGCAAATCCCCATC
TCGGATCACTGGAGCCAAAACCTGTCCCAGTTTTTCCCTGAGGCCATTTCTTTCATAGAT
GAAGCCCGGGGCAAGAACTGTGGTGTCTTGGTACATTGCTTGGCTGGCATTAGCCGCTCA
GTCACTGTGACTGTGGCTTACCTTATGCAGAAGCTCAATCTGTCGATGAACGATGCCTAT
GACATTGTCAAAATGAAAAAATCCAACATATCCCCTAACTTCAACTTCATGGGTCAGCTG
CTGGACTTCGAGAGGACGCTGGGACTCAGCAGCCCATGTGACAACAGGGTTCCAGCACAG
CAGCTGTATTTTACCACCCCTTCCAACCAGAATGTATACCAGGTGGACTCTCTGCAATCT
ACGTGA
Protein Properties
Number of Residues 381
Molecular Weight 42319.27
Theoretical pI 4.885
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Dual specificity protein phosphatase 6
MIDTLRPVPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPG
IMLRRLQKGNLPVRALFTRGEDRDRFTRRCGTDTVVLYDESSSDWNENTGGESVLGLLLK
KLKDEGCRAFYLEGGFSKFQAEFSLHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDI
ESDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVT
PNLPNLFENAGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRS
VTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQ
QLYFTTPSNQNVYQVDSLQST
GenBank ID Protein 1418934
UniProtKB/Swiss-Prot ID Q16828
UniProtKB/Swiss-Prot Entry Name DUS6_HUMAN
PDB IDs
GenBank Gene ID X93920
GeneCard ID DUSP6
GenAtlas ID DUSP6
HGNC ID HGNC:3072
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Groom LA, Sneddon AA, Alessi DR, Dowd S, Keyse SM: Differential regulation of the MAP, SAP and RK/p38 kinases by Pyst1, a novel cytosolic dual-specificity phosphatase. EMBO J. 1996 Jul 15;15(14):3621-32. [PubMed:8670865 ]
  6. Furukawa T, Yatsuoka T, Youssef EM, Abe T, Yokoyama T, Fukushige S, Soeda E, Hoshi M, Hayashi Y, Sunamura M, Kobari M, Horii A: Genomic analysis of DUSP6, a dual specificity MAP kinase phosphatase, in pancreatic cancer. Cytogenet Cell Genet. 1998;82(3-4):156-9. [PubMed:9858808 ]
  7. Stewart AE, Dowd S, Keyse SM, McDonald NQ: Crystal structure of the MAPK phosphatase Pyst1 catalytic domain and implications for regulated activation. Nat Struct Biol. 1999 Feb;6(2):174-81. [PubMed:10048930 ]