You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08915
Secondary Accession Numbers
  • 14644
Name Dual specificity protein phosphatase 8
Synonyms
  1. Dual specificity protein phosphatase hVH-5
Gene Name DUSP8
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function This protein shows both activity toward tyrosine-protein phosphate as well as with serine/threonine-protein phosphate (By similarity).
Pathways
  • MAPK signaling pathway
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
A phosphoprotein + Water → a protein + Phosphate details
GO Classification
Cellular Component
cytoplasm
nucleus
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
map kinase tyrosine/serine/threonine phosphatase activity
protein tyrosine/serine/threonine phosphatase activity
Molecular Function
MAP kinase tyrosine/serine/threonine phosphatase activity
protein tyrosine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location 11
Locus 11p15.5
SNPs DUSP8
Gene Sequence
>1878 bp
ATGGCTGGGGACCGGCTCCCGAGGAAGGTGATGGATGCCAAGAAGCTGGCCAGCCTGCTG
CGGGGCGGGCCTGGGGGGCCGCTGGTCATCGACAGCCGCTCCTTCGTGGAGTACAACAGC
TGGCATGTGCTCAGCTCCGTCAACATCTGCTGCTCCAAGCTGGTGAAGCGGCGGCTGCAG
CAGGGCAAGGTGACCATTGCGGAGCTCATCCAGCCGGCTGCACGCAGCCAGGTGGAGGCT
ACGGAGCCACAGGACGTGGTGGTCTATGACCAGAGCACGCGGGACGCCAGCGTGCTGGCC
GCAGACAGCTTCCTCTCCATCCTGCTGAGCAAGCTGGACGGCTGCTTCGACAGCGTGGCC
ATCCTCACTGGGGGCTTCGCCACCTTCTCCTCCTGCTTCCCCGGCCTCTGCGAGGGCAAG
CCTGCTGCCCTGCTACCCATGAGCCTCTCCCAGCCCTGCCTGCCTGTGCCCAGCGTGGGC
CTGACCCGCATCCTGCCTCACCTCTACCTGGGCTCGCAGAAGGACGTCCTAAACAAGGAT
CTGATGACGCAAAATGGAATAAGCTACGTCCTCAACGCCAGCAACTCCTGCCCCAAGCCT
GACTTCATCTGCGAGAGCCGCTTCATGCGGGTCCCCATCAACGACAACTACTGTGAAAAA
CTGCTGCCCTGGCTGGACAAGTCCATCGAGTTCATCGATAAAGCCAAGCTCTCCAGCTGC
CAAGTCATCGTCCACTGTCTGGCTGGCATCTCCCGCTCTGCCACCATCGCCATCGCCTAC
ATCATGAAGACCATGGGCATGTCCTCCGACGACGCCTACAGGTTCGTGAAGGACAGGCGC
CCGTCCATCTCGCCCAACTTCAACTTCCTGGGCCAGCTGCTGGAGTACGAGCGCAGCCTG
AAGCTGCTGGCCGCCCTGCAGGGCGACCCGGGCACCCCCTCAGGGACGCCGGAGCCTCCG
CCCAGTCCTGCCGCCGGGGCCCCGCTGCCACGGCTGCCACCACCTACCTCAGAGAGCGCT
GCCACAGGGAATGCGGCTGCCAGGGAGGGCGGCCTGAGCGCGGGCGGGGAGCCCCCCGCG
CCCCCCACGCCCCCGGCGACCAGCGCACTGCAGCAGGGCCTGCGCGGCCTGCACCTCTCC
TCGGACCGCCTGCAGGACACTAACCGCCTCAAGCGCTCCTTCTCCCTGGACATCAAGTCT
GCCTACGCCCCTAGCAGGCGGCCCGACGGCCCCGGGCCCCCCGACCCCGGCGAGGCCCCG
AAGCTCTGCAAGCTGGACAGCCCGTCGGGGGCCGCGCTGGGCCTGTCCTCGCCCAGCCCG
GACAGCCCGGACGCCGCGCCTGAGGCGCGCCCACGGCCCCGCCGGCGGCCCCGGCCCCCC
GCCGGCTCCCCCGCGCGCTCCCCCGCGCACAGCCTCGGCCTGAACTTCGGCGATGCGGCC
CGGCAGACTCCGCGGCACGGCCTCTCGGCCCTGTCGGCGCCCGGGCTGCCCGGCCCTGGC
CAGCCGGCCGGCCCCGGGGCCTGGGCACCGCCGCTTGACTCCCCAGGCACGCCGTCGCCC
GACGGGCCCTGGTGCTTCAGCCCCGAGGGCGCACAGGGGGCGGGCGGGGTGCTGTTTGCG
CCCTTCGGCCGGGCGGGCGCCCCGGGACCAGGCGGCGGCAGCGACCTGCGGCGGCGGGAG
GCAGCGAGGGCTGAGCCCCGGGACGCGCGGACCGGCTGGCCCGAGGAGCCGGCCCCGGAG
ACGCAGTTCAAGCGCCGCAGCTGCCAGATGGAGTTCGAGGAGGGCATGGTGGAGGGGCGC
GCGCGCGGCGAGGAGCTGGCCGCCCTGGGCAAGCAGGCGAGCTTCTCGGGCAGCGTGGAG
GTCATCGAGGTGTCCTGA
Protein Properties
Number of Residues 625
Molecular Weight 65825.96
Theoretical pI 8.234
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Dual specificity protein phosphatase 8
MAGDRLPRKVMDAKKLASLLRGGPGGPLVIDSRSFVEYNSWHVLSSVNICCSKLVKRRLQ
QGKVTIAELIQPAARSQVEATEPQDVVVYDQSTRDASVLAADSFLSILLSKLDGCFDSVA
ILTGGFATFSSCFPGLCEGKPAALLPMSLSQPCLPVPSVGLTRILPHLYLGSQKDVLNKD
LMTQNGISYVLNASNSCPKPDFICESRFMRVPINDNYCEKLLPWLDKSIEFIDKAKLSSC
QVIVHCLAGISRSATIAIAYIMKTMGMSSDDAYRFVKDRRPSISPNFNFLGQLLEYERSL
KLLAALQGDPGTPSGTPEPPPSPAAGAPLPRLPPPTSESAATGNAAAREGGLSAGGEPPA
PPTPPATSALQQGLRGLHLSSDRLQDTNRLKRSFSLDIKSAYAPSRRPDGPGPPDPGEAP
KLCKLDSPSGAALGLSSPSPDSPDAAPEARPRPRRRPRPPAGSPARSPAHSLGLNFGDAA
RQTPRHGLSALSAPGLPGPGQPAGPGAWAPPLDSPGTPSPDGPWCFSPEGAQGAGGVLFA
PFGRAGAPGPGGGSDLRRREAARAEPRDARTGWPEEPAPETQFKRRSCQMEFEEGMVEGR
ARGEELAALGKQASFSGSVEVIEVS
GenBank ID Protein 54887329
UniProtKB/Swiss-Prot ID Q13202
UniProtKB/Swiss-Prot Entry Name DUS8_HUMAN
PDB IDs Not Available
GenBank Gene ID BC038231
GeneCard ID DUSP8
GenAtlas ID DUSP8
HGNC ID HGNC:3074
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Martell KJ, Seasholtz AF, Kwak SP, Clemens KK, Dixon JE: hVH-5: a protein tyrosine phosphatase abundant in brain that inactivates mitogen-activated protein kinase. J Neurochem. 1995 Oct;65(4):1823-33. [PubMed:7561881 ]