Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08917
Secondary Accession Numbers
  • 14646
Name Lipid phosphate phosphatase-related protein type 2
Synonyms
  1. PRG-4
  2. Plasticity-related gene 4 protein
Gene Name LPPR2
Protein Type Enzyme
Biological Properties
General Function Involved in catalytic activity
Specific Function Not Available
Pathways Not Available
Reactions
A 1,2-diacylglycerol 3-phosphate + Water → a 1,2-diacyl-sn-glycerol + Phosphate details
GO Classification
Biological Process
metabolic process
Cellular Component
integral to membrane
Component
membrane
cell part
Function
catalytic activity
Molecular Function
phosphatidate phosphatase activity
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location 19
Locus 19p13.2
SNPs LPPR2
Gene Sequence
>1032 bp
ATGGCGGGAGGGAGACCGCATCTGAAGAGGAGTTTCTCCATCATCCCCTGCTTTGTCTTC
GTGGAGTCGGTGCTGCTGGGCATTGTGATCCTGCTTGCTTACCGCCTGGAGTTCACGGAC
ACCCTCCCTGTGCACACCCAGGGATTCTTCTGCTATGACAGTACCTACGCCAAGCCCTAC
CCAGGGCCTGAGGCTGCCAGCCGAGTGCCTCCTGCTCTTGTCTACGCACTGGTCACTGCC
GGGCCCACCCTCACGATCCTGCTGGGAGAGCTGGCGCGTGCCTTTTTCCCTGCACCACCT
TCAGCCGTCCCAGTCATCGGGGAGAGCACCATCGTGTCTGGGGCCTGCTGCCGCTTCAGC
CCCCCAGTGCGGAGGCTGGTCCGCTTCCTGGGGGTCTACTCCTTCGGCCTCTTCACCACG
ACCATCTTCGCCAACGCGGGGCAGGTGGTGACCGGCAATCCCACGCCACACTTCCTGTCC
GTGTGCCGCCCCAACTACACGGCCCTGGGCTGCCTGCCACCTTCTCCGGATCGGCCAGGT
CCCGACCGCTTTGTCACTGACCAGGGTGCCTGCGCTGGCAGTCCCAGCCTCGTGGCCGCC
GCGCGCCGCGCCTTCCCCTGCAAGGATGCGGCCCTCTGCGCCTACGCGGTCACCTACACA
GCGATGTACGTGACTCTCGTGTTCCGCGTGAAGGGCTCCCGCCTGGTCAAACCCTCGCTC
TGCCTGGCCTTGCTGTGCCCGGCCTTCCTGGTGGGCGTGGTCCGCGTGGCCGAGTACCGA
AACCACTGGTCGGACGTGCTGGCTGGCTTCCTGACAGGGGCGGCCATCGCCACCTTTTTG
GTCACCTGCGTTGTGCATAACTTTCAGAGCCGGCCACCCTCTGGCCGAAGGCTCTCTCCC
TGGGAGGACCTGGGCCAAGCCCCCACCATGGATAGCCCCCTCGAAAAGAACCCGAGGTCT
GCAGGCCGCATTCGACACCGGCACGGCTCACCCCATCCAAGTCGCAGAACTGCGCCCGCC
GTGGCCACCTGA
Protein Properties
Number of Residues 343
Molecular Weight 45575.37
Theoretical pI 9.528
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Lipid phosphate phosphatase-related protein type 2
MAGGRPHLKRSFSIIPCFVFVESVLLGIVILLAYRLEFTDTFPVHTQGFFCYDSTYAKPY
PGPEAASRVPPALVYALVTAGPTLTILLGELARAFFPAPPSAVPVIGESTIVSGACCRFS
PPVRRLVRFLGVYSFGLFTTTIFANAGQVVTGNPTPHFLSVCRPNYTALGCLPPSPDRPG
PDRFVTDQGACAGSPSLVAAARRAFPCKDAALCAYAVTYTAMYVTLVFRVKGSRLVKPSL
CLALLCPAFLVGVVRVAEYRNHWSDVLAGFLTGAAIATFLVTCVVHNFQSRPPSGRRLSP
WEDLGQAPTMDSPLEKNPRSAGRIRHRHGSPHPSRRTAPAVAT
GenBank ID Protein 10434892
UniProtKB/Swiss-Prot ID Q96GM1
UniProtKB/Swiss-Prot Entry Name LPPR2_HUMAN
PDB IDs Not Available
GenBank Gene ID AK023117
GeneCard ID LPPR2
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  4. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  5. Savaskan NE, Brauer AU, Nitsch R: Molecular cloning and expression regulation of PRG-3, a new member of the plasticity-related gene family. Eur J Neurosci. 2004 Jan;19(1):212-20. [PubMed:14750979 ]