You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08920
Secondary Accession Numbers
  • 14649
Name M-phase inducer phosphatase 2
Synonyms
  1. Dual specificity phosphatase Cdc25B
Gene Name CDC25B
Protein Type Enzyme
Biological Properties
General Function Involved in protein tyrosine phosphatase activity
Specific Function Tyrosine protein phosphatase which functions as a dosage-dependent inducer of mitotic progression. Required for G2/M phases of the cell cycle progression and abscission during cytokinesis in a ECT2-dependent manner. Directly dephosphorylates CDK1 and stimulates its kinase activity. The three isoforms seem to have a different level of activity.
Pathways
  • Cell cycle
  • MAPK signaling pathway
  • Progesterone-mediated oocyte maturation
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
GO Classification
Biological Process
cell division
female meiosis I
oocyte maturation
positive regulation of cell cycle cytokinesis
positive regulation of protein kinase activity
positive regulation of cell proliferation
positive regulation of mitotic cell cycle
G2/M transition of mitotic cell cycle
protein phosphorylation
mitosis
Cellular Component
cytosol
centrosome
nucleoplasm
spindle pole
Component
cell part
intracellular
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
Molecular Function
protein tyrosine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
m phase
dephosphorylation
m phase of mitotic cell cycle
protein amino acid dephosphorylation
metabolic process
cellular process
cellular metabolic process
cell cycle process
cell cycle phase
Cellular Location
  1. Cytoplasm
  2. cytoskeleton
  3. centrosome
Gene Properties
Chromosome Location 20
Locus 20p13
SNPs CDC25B
Gene Sequence
>1743 bp
ATGGAGGTGCCCCAGCCGGAGCCCGCGCCAGGCTCGGCTCTCAGTCCAGCAGGCGTGTGC
GGTGGCGCCCAGCGTCCGGGCCACCTCCCGGGCCTCCTGCTGGGATCTCATGGCCTCCTG
GGGTCCCCGGTGCGGGCGGCCGCTTCCTCGCCGGTCACCACCCTCACCCAGACCATGCAC
GACCTCGCCGGGCTCGGCAGCGAAACCCCAAAGAGTCAGGTAGGGACCCTGCTCTTCCGC
AGCCGCAGCCGCCTGACGCACCTATCCCTGTCTCGACGGGCATCCGAATCCTCCCTGTCG
TCTGAATCCTCCGAATCTTCTGATGCAGGTCTCTGCATGGATTCCCCCAGCCCTATGGAC
CCCCACATGGCGGAGCAGACGTTTGAACAGGCCATCCAGGCAGCCAGCCGGATCATTCGA
AACGAGCAGTTTGCCATCAGACGCTTCCAGTCTATGCCGGTGAGGCTGCTGGGCCACAGC
CCCGTGCTTCGGAACATCACCAACTCCCAGGCGCCCGACGGCCGGAGGAAGAGCGAGGCG
GGCAGTGGAGCTGCCAGCAGCTCTGGGGAAGACAAGGAGAATGATGGATTTGTCTTCAAG
ATGCCATGGAAGCCCACACATCCCAGCTCCACCCATGCTCTGGCAGAGTGGGCCAGCCGC
AGGGAAGCCTTTGCCCAGAGACCCAGCTCGGCCCCCGACCTGATGTGTCTCAGTCCTGAC
CGGAAGATGGAAGTGGAGGAGCTCAGCCCCCTGGCCCTAGGTCGCTTCTCTCTGACCCCT
GCAGAGGGGGATACTGAGGAAGATGATGGATTTGTGGACATCCTAGAGAGTGACTTAAAG
GATGATGATGCAGTTCCCCCAGGCATGGAGAGTCTCATTAGTGCCCCACTGGTCAAGACC
TTGGAAAAGGAAGAGGAAAAGGACCTCGTCATGTACAGCAAGTGCCAGCGGCTCTTCCGC
TCTCCGTCCATGCCCTGCAGCGTGATCCGGCCCATCCTCAAGAGGCTGGAGCGGCCCCAG
GACAGGGACACGCCCGTGCAGAATAAGCGGAGGCGGAGCGTGACCCCTCCTGAGGAGCAG
CAGGAGGCTGAGGAACCTAAAGCCCGCGTCCTCCGCTCAAAATCACTGTGTCACGATGAG
ATCGAGAACCTCCTGGACAGTGACCACCGAGAGCTGATTGGAGATTACTCTAAGGCCTTC
CTCCTACAGACAGTAGACGGAAAGCACCAAGACCTCAAGTACATCTCACCAGAAACGATG
GTGGCCCTATTGACGGGCAAGTTCAGCAACATCGTGGATAAGTTTGTGATTGTAGACTGC
AGATACCCCTATGAATATGAAGGCGGGCACATCAAGACTGCGGTGAACTTGCCCCTGGAA
CGCGACGCCGAGAGCTTCCTACTGAAGAGCCCCATCGCGCCCTGTAGCCTGGACAAGAGA
GTCATCCTCATTTTCCACTGTGAATTCTCATCTGAGCGTGGGCCCCGCATGTGCCGTTTC
ATCAGGGAACGAGACCGTGCTGTCAACGACTACCCCAGCCTCTACTACCCTGAGATGTAT
ATCCTGAAAGGCGGCTACAAGGAGTTCTTCCCTCAGCACCCGAACTTCTGTGAACCCCAG
GACTACCGGCCCATGAACCACGAGGCCTTCAAGGATGAGCTAAAGACCTTCCGCCTCAAG
ACTCGCAGCTGGGCTGGGGAGCGGAGCCGGCGGGAGCTCTGTAGCCGGCTGCAGGACCAG
TGA
Protein Properties
Number of Residues 580
Molecular Weight 63441.985
Theoretical pI 6.313
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>M-phase inducer phosphatase 2
MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASSPVTTLTQTMH
DLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSESSDAGLCMDSPSPMD
PHMAEQTFEQAIQAASRIIRNEQFAIRRFQSMPVRLLGHSPVLRNITNSQAPDGRRKSEA
GSGAASSSGEDKENDGFVFKMPWKPTHPSSTHALAEWASRREAFAQRPSSAPDLMCLSPD
RKMEVEELSPLALGRFSLTPAEGDTEEDDGFVDILESDLKDDDAVPPGMESLISAPLVKT
LEKEEEKDLVMYSKCQRLFRSPSMPCSVIRPILKRLERPQDRDTPVQNKRRRSVTPPEEQ
QEAEEPKARVLRSKSLCHDEIENLLDSDHRELIGDYSKAFLLQTVDGKHQDLKYISPETM
VALLTGKFSNIVDKFVIVDCRYPYEYEGGHIKTAVNLPLERDAESFLLKSPIAPCSLDKR
VILIFHCEFSSERGPRMCRFIRERDRAVNDYPSLYYPEMYILKGGYKEFFPQHPNFCEPQ
DYRPMNHEAFKDELKTFRLKTRSWAGERSRRELCSRLQDQ
GenBank ID Protein 11641413
UniProtKB/Swiss-Prot ID P30305
UniProtKB/Swiss-Prot Entry Name MPIP2_HUMAN
PDB IDs
GenBank Gene ID NM_021873.2
GeneCard ID CDC25B
GenAtlas ID CDC25B
HGNC ID HGNC:1726
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J: The DNA sequence and comparative analysis of human chromosome 20. Nature. 2001 Dec 20-27;414(6866):865-71. [PubMed:11780052 ]
  3. Kramer A, Mailand N, Lukas C, Syljuasen RG, Wilkinson CJ, Nigg EA, Bartek J, Lukas J: Centrosome-associated Chk1 prevents premature activation of cyclin-B-Cdk1 kinase. Nat Cell Biol. 2004 Sep;6(9):884-91. Epub 2004 Aug 15. [PubMed:15311285 ]
  4. Galaktionov K, Beach D: Specific activation of cdc25 tyrosine phosphatases by B-type cyclins: evidence for multiple roles of mitotic cyclins. Cell. 1991 Dec 20;67(6):1181-94. [PubMed:1836978 ]
  5. Nagata A, Igarashi M, Jinno S, Suto K, Okayama H: An additional homolog of the fission yeast cdc25+ gene occurs in humans and is highly expressed in some cancer cells. New Biol. 1991 Oct;3(10):959-68. [PubMed:1662986 ]
  6. Baldin V, Cans C, Superti-Furga G, Ducommun B: Alternative splicing of the human CDC25B tyrosine phosphatase. Possible implications for growth control? Oncogene. 1997 May 22;14(20):2485-95. [PubMed:9188863 ]
  7. Reynolds RA, Yem AW, Wolfe CL, Deibel MR Jr, Chidester CG, Watenpaugh KD: Crystal structure of the catalytic subunit of Cdc25B required for G2/M phase transition of the cell cycle. J Mol Biol. 1999 Oct 29;293(3):559-68. [PubMed:10543950 ]