You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08922
Secondary Accession Numbers
  • 14651
Name Myotubularin-related protein 4
Synonyms
  1. FYVE domain-containing dual specificity protein phosphatase 2
  2. FYVE-DSP2
  3. Zinc finger FYVE domain-containing protein 11
Gene Name MTMR4
Protein Type Unknown
Biological Properties
General Function Involved in phosphatase activity
Specific Function Dephosphorylates proteins phosphorylated on Ser, Thr, and Tyr residues and low molecular weight phosphatase substrate para-nitrophenylphosphate. Phosphorylates phosphatidylinositol 3,4,5-trisphosphate (PIP3).
Pathways Not Available
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
GO Classification
Biological Process
small molecule metabolic process
phosphatidylinositol biosynthetic process
negative regulation of transforming growth factor beta receptor signaling pathway
transforming growth factor beta receptor signaling pathway
Cellular Component
cytosol
early endosome membrane
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
ion binding
cation binding
metal ion binding
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
transition metal ion binding
zinc ion binding
phosphoric ester hydrolase activity
phosphatase activity
Molecular Function
protein serine/threonine phosphatase activity
metal ion binding
protein tyrosine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Cytoplasm
  2. Peripheral membrane protein
  3. Membrane
Gene Properties
Chromosome Location 17
Locus 17q22-q23
SNPs MTMR4
Gene Sequence
>3588 bp
ATGGGTGAGGAGGGGCCCCCCAGCCTGGAGTACATCCAAGCCAAGGATCTGTTCCCCCCC
AAGGAACTAGTGAAGGAGGAAGAGAATCTTCAGGTCCCCTTCACAGTGCTGCAGGGTGAG
GGAGTAGAGTTCCTGGGCCGGGCAGCCGATGCCCTCATTGCCATCTCTAACTACCGGCTG
CATATCAAATTCAAGGACTCTGTCATCAACGTCCCCCTCCGGATGATTGACAGTGTGGAG
AGCCGTGATATGTTCCAGTTGCACATTTCCTGCAAGGACTCCAAAGTGGTGAGGTGCCAC
TTCTCCACTTTTAAGCAGTGCCAAGAGTGGCTCTCACGGCTAAGCCGAGCCACAGCAAGA
CCTGCCAAGCCTGAAGACCTCTTTGCCTTTGCCTACCATGCCTGGTGCCTGGGGCTGACC
GAGGAGGACCAGCACACTCACCTATGTCAGCCAGGTGAGCACATACGTTGTCGACAGGAG
GCGGAGCTTGCAAGGATGGGCTTTGACGTGCAGAACGTCTGGAGAGTCTCACACATCAAC
AGCAACTACAAATTGTGCCCCAGTTACCCCCAGAAGCTGCTGGTTCCTGTGTGGATCACT
GACAAAGAGCTGGAGAACGTGGCTTCCTTCCGCTCCTGGAAGCGGATTCCCGTGGTTGTG
TATAGACACTTGCGCAATGGGGCTGCCATCGCCCGCTGCAGCCAGCCAGAGATCAGCTGG
TGGGGCTGGCGCAATGCTGATGATGAGTACCTGGTCACGTCCATTGCTAAAGCCTGTGCC
CTGGACCCGGGGACAAGGGCCACTGGGGGCTCCCTCAGCACCGGGAATAATGATACCAGC
GAGGCGTGTGATGCTGACTTTGATTCTTCTCTGACTGCGTGCTCTGGAGTGGAGAGCACA
GCAGCTCCTCAAAAGCTGCTGATCCTGGATGCGCGATCCTACACGGCAGCAGTGGCCAAC
CGGGCCAAGGGTGGAGGCTGTGAATGTGAAGAGTACTATCCCAACTGTGAGGTCGTGTTC
ATGGGAATGGCCAACATCCATGCCATCCGGAACAGCTTTCAGTACCTCCGGGCTGTGTGT
AGCCAGATGCCGGATCCTAGCAACTGGTTGTCGGCACTGGAGAGTACCAAATGGCTGCAG
CACTTGTCGGTGATGCTAAAAGCAGCTGTGCTGGTGGCTAATACAGTAGACCGGGAAGGC
CGGCCTGTGCTGGTACACTGCTCAGATGGCTGGGACCGCACACCGCAGATCGTAGCCCTG
GCCAAAATATTACTGGACCCATATTACAGGACGTTGGAGGGCTTCCAAGTGTTAGTGGAG
TCTGACTGGCTGGATTTTGGGCACAAGTTTGGAGATCGCTGTGGCCACCAAGAGAATGTG
GAGGACCAAAACGAACAATGCCCTGTGTTCCTCCAGTGGCTTGATTCTGTTCATCAGTTG
CTTAAGCAGTTCCCCTGCCTGTTTGAATTTAATGAAGCATTCCTGGTAAAACTGGTGCAA
CACACATACTCCTGCCTCTACGGCACCTTCCTGGCCAACAACCCCTGTGAGCGAGAGAAG
CGCAACATCTACAAGCGGACCTGCTCTGTGTGGGCGCTCCTTCGAGCTGGCAATAAAAAC
TTTCATAACTTCCTCTACACACCCAGCTCAGACATGGTCCTGCATCCTGTTTGTCATGTC
CGGGCCCTGCACCTCTGGACAGCTGTTTATCTGCCAGCATCATCTCCATGCACACTTGGG
GAAGAAAACATGGATCTTTACCTTTCCCCAGTGGCCCAGAGCCAGGAGTTCTCTGGCCGC
TCTCTGGACAGATTACCTAAAACCAGATCCATGGATGATCTTCTTTCTGCCTGTGACACA
AGCAGCCCCCTGACTCGTACATCCAGTGACCCTAACCTGAATAACCACTGTCAGGAGGTC
AGGGTAGGCCTGGAGCCCTGGCACAGCAATCCTGAGGGATCAGAGACAAGCTTTGTGGAC
TCTGGGGTAGGAGGGCCTCAGCAAACTGTAGGAGAAGTGGGTCTTCCTCCTCCTCTGCCC
AGCAGCCAGAAAGACTACTTGAGCAATAAACCTTTCAAGAGTCACAAAAGCTGTTCTCCA
AGTTACAAACTGCTTAATACCGCAGTGCCTCGGGAAATGAAGAGCAACACCTCTGATCCT
GAGATCAAAGTCCTAGAAGAGACTAAGGGACCAGCTCCAGACCCTTCTGCCCAGGATGAG
CTGGGTAGGACTTTAGATGGCATAGGGGAGCCACCTGAACATTGTCCTGAAACAGAAGCT
GTCAGTGCACTCTCCAAGGTCATTTCTAACAAGTGTGATGGAGTTTGTAATTTTCCTGAG
TCTTCCCAGAACTCTCCTACAGGTACGCCCCAACAGGCCCAGCCAGACTCCATGCTAGGT
GTGCCCTCCAAGTGTGTTCTTGATCACAGCCTCAGCACCGTTTGCAACCCACCGAGTGCT
GCCTGCCAAACTCCTCTAGACCCAAGCACTGACTTCCTCAACCAAGATCCCTCAGGGTCT
GTGGCAAGTATCTCCCACCAGGAACAACTGAGTTCTGTGCCGGATCTGACCCATGGGGAG
GAAGACATTGGTAAAAGAGGAAATAATAGGAATGGGCAGTTATTGGAAAATCCTCGCTTT
GGGAAAATGCCATTGGAATTGGTCCGGAAGCCAATTTCTCAGAGCCAGATCAGTGAGTTC
TCTTTTCTAGGGTCCAACTGGGACAGCTTCCAAGGGATGGTGACTTCATTCCCAAGTGGG
GAGGCCACCCCTCGGCGGCTGCTTTCCTATGGCTGTTGTAGCAAGAGGCCAAACAGTAAG
CAGATGCGGGCCACAGGGCCCTGCTTTGGGGGCCAGTGGGCTCAGAGAGAAGGTGTGAAG
TCACCTGTCTGTTCTAGTCATTCCAATGGACATTGTACTGGCCCAGGAGGAAAGAACCAG
ATGTGGTTGTCCAGTCATCCAAAGCAAGTCTCTAGCACAAAGCCCGTTCCACTGAACTGC
CCTTCTCCAGTGCCTCCTCTGTATTTGGATGATGATGGACTCCCCTTTCCCACGGATGTG
ATCCAGCATAGGTTACGGCAAATCGAAGCAGGGTACAAACAAGAGGTGGAGCAGCTACGT
CGACAGGTGCGTGAGCTTCAGATGAGGCTGGACATCCGTCACTGCTGTGCCCCTCCAGCA
GAGCCCCCCATGGACTATGAGGATGATTTTACATGTTTGAAGGAGTCAGATGGCAGTGAT
ACTGAGGATTTTGGCTCTGATCACAGTGAAGACTGCCTTTCAGAAGCAAGCTGGGAACCT
GTTGATAAGAAAGAGACTGAGGTGACTCGCTGGGTTCCAGACCATATGGCATCACACTGC
TATAACTGTGACTGTGAATTCTGGTTGGCCAAACGAAGACACCATTGCAGAAATTGTGGG
AATGTATTTTGTGCTGGATGCTGCCACCTGAAGCTGCCCATTCCTGATCAGCAACTCTAT
GACCCAGTTCTCGTCTGTAACTCATGTTACGAACACATTCAAGTCTCTCGTGCCAGGGAA
CTCATGAGCCAACAGCTGAAGAAACCCATTGCTACAGCTTCCAGTTGA
Protein Properties
Number of Residues 1195
Molecular Weight 133352.17
Theoretical pI 6.043
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Myotubularin-related protein 4
MGEEGPPSLEYIQAKDLFPPKELVKEEENLQVPFTVLQGEGVEFLGRAADALIAISNYRL
HIKFKDSVINVPLRMIDSVESRDMFQLHISCKDSKVVRCHFSTFKQCQEWLSRLSRATAR
PAKPEDLFAFAYHAWCLGLTEEDQHTHLCQPGEHIRCRQEAELARMGFDLQNVWRVSHIN
SNYKLCPSYPQKLLVPVWITDKELENVASFRSWKRIPVVVYRHLRNGAAIARCSQPEISW
WGWRNADDEYLVTSIAKACALDPGTRATGGSLSTGNNDTSEACDADFDSSLTACSGVEST
AAPQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVVFMGMANIHAIRNSFQYLRAVC
SQMPDPSNWLSALESTKWLQHLSVMLKAAVLVANTVDREGRPVLVHCSDGWDRTPQIVAL
AKILLDPYYRTLEGFQVLVESDWLDFGHKFGDRCGHQENVEDQNEQCPVFLQWLDSVHQL
LKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLANNPCEREKRNIYKRTCSVWALLRAGNKN
FHNFLYTPSSDMVLHPVCHVRALHLWTAVYLPASSPCTLGEENMDLYLSPVAQSQEFSGR
SLDRLPKTRSMDDLLSACDTSSPLTRTSSDPNLNNHCQEVRVGLEPWHSNPEGSETSFVD
SGVGGPQQTVGEVGLPPPLPSSQKDYLSNKPFKSHKSCSPSYKLLNTAVPREMKSNTSDP
EIKVLEETKGPAPDPSAQDELGRTLDGIGEPPEHCPETEAVSALSKVISNKCDGVCNFPE
SSQNSPTGTPQQAQPDSMLGVPSKCVLDHSLSTVCNPPSAACQTPLDPSTDFLNQDPSGS
VASISHQEQLSSVPDLTHGEEDIGKRGNNRNGQLLENPRFGKMPLELVRKPISQSQISEF
SFLGSNWDSFQGMVTSFPSGEATPRRLLSYGCCSKRPNSKQMRATGPCFGGQWAQREGVK
SPVCSSHSNGHCTGPGGKNQMWLSSHPKQVSSTKPVPLNCPSPVPPLYLDDDGLPFPTDV
IQHRLRQIEAGYKQEVEQLRRQVRELQMRLDIRHCCAPPAEPPMDYEDDFTCLKESDGSD
TEDFGSDHSEDCLSEASWEPVDKKETEVTRWVPDHMASHCYNCDCEFWLAKRRHHCRNCG
NVFCAGCCHLKLPIPDQQLYDPVLVCNSCYEHIQVSRARELMSQQLKKPIATASS
GenBank ID Protein 20521119
UniProtKB/Swiss-Prot ID Q9NYA4
UniProtKB/Swiss-Prot Entry Name MTMR4_HUMAN
PDB IDs Not Available
GenBank Gene ID AB014547
GeneCard ID MTMR4
GenAtlas ID MTMR4
HGNC ID HGNC:7452
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]
  3. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  4. Ishikawa K, Nagase T, Suyama M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Jun 30;5(3):169-76. [PubMed:9734811 ]
  5. Zhao R, Qi Y, Chen J, Zhao ZJ: FYVE-DSP2, a FYVE domain-containing dual specificity protein phosphatase that dephosphorylates phosphotidylinositol 3-phosphate. Exp Cell Res. 2001 May 1;265(2):329-38. [PubMed:11302699 ]