Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08928
Secondary Accession Numbers
  • 14657
Name Tyrosine-protein phosphatase non-receptor type 13
Synonyms
  1. FAP-1
  2. Fas-associated protein-tyrosine phosphatase 1
  3. PTP-BAS
  4. PTP-E1
  5. Protein-tyrosine phosphatase 1E
  6. Protein-tyrosine phosphatase PTPL1
  7. hPTPE1
Gene Name PTPN13
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function Tyrosine phosphatase which regulates negatively FAS-induced apoptosis and NGFR-mediated pro-apoptotic signaling.
Pathways Not Available
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
GO Classification
Cellular Component
cytoskeleton
cytoplasm
plasma membrane
nucleus
cell body
lamellipodium
neuron projection
Component
cytoskeleton
organelle
non-membrane-bounded organelle
intracellular non-membrane-bounded organelle
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
protein binding
Molecular Function
protein tyrosine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Cytoplasm
  2. cytoskeleton
Gene Properties
Chromosome Location 4
Locus 4q21.3
SNPs PTPN13
Gene Sequence
>7458 bp
ATGCACGTGTCACTAGCTGAGGCCCTGGAGGTTCGGGGTGGACCACTTCAGGAGGAAGAA
ATATGGGCTGTATTAAATCAAAGTGCTGAAAGTCTCCAAGAATTATTCAGAAAAGTAAGC
CTAGCTGATCCTGCTGCCCTTGGCTTCATCATTTCTCCATGGTCTCTGCTGTTGCTGCCA
TCTGGTAGTGTGTCATTTACAGATGAAAATATTTCCAATCAGGATCTTCGAGCATTCACT
GCACCAGAGGTTCTTCAAAATCAGTCACTAACTTCTCTCTCAGATGTTGAAAAGATCCAC
ATTTATTCTCTTGGAATGACACTGTATTGGGGGGCTGATTATGAAGTGCCTCAGAGCCAA
CCTATTAAGCTTGGAGATCATCTCAACAGCATACTGCTTGGAATGTGTGAGGATGTTATT
TACGCTCGAGTTTCTGTTCGGACTGTGCTGGATGCTTGCAGTGCCCACATTAGGAATAGC
AATTGTGCACCCTCATTTTCCTACGTGAAACACTTGGTAAAACTGGTTCTGGGAAATCTT
TCTGGGACAGATCAGCTTTCCTGTAACAGTGAACAAAAGCCTGATCGAAGCCAGGCTATT
CGAGATCGATTGCGAGGAAAAGGATTACCAACAGGAAGAAGCTCTACTTCTGATGTACTA
GACATACAAAAGCCTCCACTCTCTCATCAGACCTTTCTTAACAAAGGGCTTAGTAAATCT
ATGGGATTTCTGTCCATCAAAGATACACAAGATGAGAATTATTTCAAGGACATTTTATCA
GATAATTCTGGACGTGAAGATTCTGAAAATACATTCTCCCCTTACCAGTTCAAAACTAGT
GGCCCAGAAAAAAAACCCATCCCTGGCATTGATGTGCTTTCTAAGAAGAAGATCTGGGCT
TCATCCATGGACTTGCTTTGTACAGCTGACAGAGACTTCTCTTCAGGAGAGACTGCCACA
TATCGTCGTTGTCACCCTGAGGCAGTAACAGTGCGGACTTCAACTACTCCTAGAAAAAAG
GAGGCAAGATACTCAGATGGAAGTATAGCCTTGGATATCTTTGGCCCTCAGAAAATGGAT
CCAATATATCACACTCGAGAATTGCCCACCTCCTCAGCAATATCAAGTGCTTTGGACCGA
ATCCGAGAGAGACAAAAGAAACTTCAGGTTCTGAGGGAAGCCATGAATGTAGAAGAACCA
GTTCGAAGATACAAAACTTATCATGGTGATGTCTTTAGTACCTCCAGTGAAAGTCCATCT
ATTATTTCCTCTGAATCAGATTTCAGACAAGTGAGAAGAAGTGAAGCCTCAAAGAGGTTT
GAATCCAGCAGTGGTCTCCCAGGGGTAGATGAAACCTTAAGTCAAGGCCAGTCACAGAGA
CCGAGCAGACAATATGAAACACCCTTTGAAGGCAACTTAATTAATCAAGAGATCATGCTA
AAACGGCAAGAGGAAGAACTGATGCAGCTACAAGCCAAAATGGCCCTTAGACAGTCTCGG
TTGAGCCTATATCCAGGAGACACAATCAAAGCGTCCATGCTTGACATCACCAGGGATCCG
TTAAGAGAAATTGCCCTAGAAACAGCCATGACTCAAAGAAAACTGAGGAATTTCTTTGGC
CCTGAGTTTGTGAAAATGACAATTGAACCATTTATATCTTTGGATTTGCCACGGTCTATT
CTTACTAAGAAAGGGAAGAATGAGGATAACCGAAGGAAAGTAAACATAATGCTTCTGAAC
GGGCAAAGACTGGAACTGACCTGTGATACCAAAACTATATGTAAAGATGTGTTTGATATG
GTTGTGGCACATATTGGCTTAGTAGAGCATCATTTGTTTGCTTTAGCTACCCTCAAAGAT
AATGAATATTTCTTTGTTGATCCTGACTTAAAATTAACCAAAGTGGCCCCAGAGGGATGG
AAAGAAGAACCAAAGAAAAAGACCAAAGCCACTGTTAATTTTACTTTGTTTTTCAGAATT
AAATTTTTTATGGATGATGTTAGTCTAATACAACATACTCTGACGTGTCATCAGTATTAC
CTTCAGCTTCGAAAAGATATTTTGGAGGAAAGGATGCACTGTGATGATGAGACTTCCTTA
TTGCTGGCATCCTTGGCTCTCCAGGCTGAGTATGGAGATTATCAACCAGAGGTTCATGGT
GTGTCTTACTTTAGAATGGAGCACTATTTGCCCGCCAGAGTGATGGAGAAACTTGATTTA
TCCTATATCAAAGAAGAGTTACCCAAATTGCATAATACCTATGTGGGAGCTTCTGAAAAA
GAGACAGAGTTAGAATTTTTAAAGGTCTGCCAAAGACTGACAGAATATGGAGTTCATTTT
CACCGAGTGCACCCTGAGAAGAAGTCACAAACAGGAATATTGCTTGGAGTCTGTTCTAAA
GGTGTCCTTGTGTTTGAAGTTCACAATGGAGTGCGCACATTGGTCCTTCGCTTTCCATGG
AGGGAAACCAAGAAAATATCTTTTTCTAAAAAGAAAATCACATTGCAAAATACATCAGAT
GGAATAAAACATGGCTTCCAGACAGACAACAGTAAGATATGCCAGTACCTGCTGCACCTC
TGCTCTTACCAGCATAAGTTCCAGCTACAGATGAGAGCAAGACAGAGCAACCAAGATGCC
CAAGATATTGAGAGAGCTTCGTTTAGGAGCCTGAATCTCCAAGCAGAGTCTGTTAGAGGA
TTTAATATGGGACGAGCAATCAGCACTGGCAGTCTGGCCAGCAGCACCCTCAACAAACTT
GCTGTTCGACCTTTATCAGTTCAAGCTGAGATTCTGAAGAGGCTATCCTGCTCAGAGCTG
TCGCTTTACCAGCCATTGCAAAACAGTTCAAAAGAGAAGAATGACAAAGCTTCATGGGAG
GAAAAGCCTAGAGAGATGAGTAAATCATACCATGATCTCAGTCAGGCCTCTCTCTATCCA
CATCGGAAAAATGTCATTGTTAACATGGAACCCCCACCACAAACCGTTGCAGAGTTGGTG
GGAAAACCTTCTCACCAGATGTCAAGATCTGATGCAGAATCTTTGGCAGGAGTGACAAAA
CTTAATAATTCAAAGTCTGTTGCGAGTTTAAATAGAAGTCCTGAAAGGAGGAAACATGAA
TCAGACTCCTCATCCATTGAAGACCCTGGGCAAGCATATGTTCTAGGAATGACTATGCAT
AGTTCTGGAAACTCTTCATCCCAAGTACCCTTAAAAGAAAATGATGTGCTACACAAAAGA
TGGAGCATAGTATCTTCACCAGAAAGGGAGATCACCTTAGTGAACCTGAAAAAAGATGCA
AAGTATGGCTTGGGATTTCAAATTATTGGTGGGGAGAAGATGGGAAGACTGGACCTAGGC
ATATTTATCAGTTCAGTTGCCCCTGGAGGACCAGCTGACTTGGATGGATGCTTGAAGCCA
GGAGACCGTTTGATATCTGTGAATAGTGTGAGTCTGGAGGGAGTCAGCCACCATGCTGCA
ATTGAAATTTTGCAAAATGCACCTGAAGATGTGACACTTGTTATCTCTCAGCCAAAAGAA
AAGATATCCAAAGTGCCTTCTACTCCTGTGCATCTCACCAATGAGATGAAAAACTACATG
AAGAAATCTTCCTACATGCAAGACAGTGCTATAGATTCTTCTTCCAAGGATCACCACTGG
TCACGTGGTACCCTGAGGCACATCTCGGAGAACTCCTTTGGGCCATCTGGGGGCCTGCGG
GAAGGAAGCCTGAGTTCTCAAGATTCCAGGACTGAGAGTGCCAGCTTGTCTCAAAGCCAG
GTCAATGGTTTCTTTGCCAGCCATTTAGGTGACCAAACCTGGCAGGAATCACAGCATGGC
AGCCCTTCCCCATCTGTAATATCCAAAGCCACCGAGAAAGAGACTTTCACTGATAGTAAC
CAAAGCAAAACTAAAAAGCCAGGCATTTCTGATGTAACTGATTACTCAGACCGTGGAGAT
TCAGACATGGATGAAGCCACTTACTCCAGCAGTCAGGATCATCAAACACCAAAACAGGAA
TCTTCCTCTTCAGTGAATACATCCAACAAGATGAATTTTAAAACTTTTTCTTCATCACCT
CCTAAGCCTGGAGATATCTTTGAGGTTGAACTGGCTAAAAATGATAACAGCTTGGGGATA
AGTGTCACGGGAGGTGTGAATACGAGTGTCAGACATGGTGGCATTTATGTGAAAGCTGTT
ATTCCCCAGGGAGCAGCAGAGTCTGATGGTAGAATTCACAAAGGTGATCGCGTCCTAGCT
GTCAATGGAGTTAGTCTAGAAGGAGCCACCCATAAGCAAGCTGTGGAAACACTGAGAAAT
ACAGGACAGGTGGTTCATCTGTTATTAGAAAAGGGACAATCTCCAACATCTAAAGAACAT
GTCCCGGTAACCCCACAGTGTACCCTTTCAGATCAGAATGCCCAAGGTCAAGGCCCAGAA
AAAGTGAAGAAAACAACTCAGGTCAAAGACTACAGCTTTGTCACTGAAGAAAATACATTT
GAGGTAAAATTATTTAAAAATAGCTCAGGTCTAGGATTCAGTTTTTCTCGAGAAGATAAT
CTTATACCGGAGCAAATTAATGCCAGCATAGTAAGGGTTAAAAAGCTCTTTCCTGGACAG
CCAGCAGCAGAAAGTGGAAAAATTGATGTAGGAGATGTTATCTTGAAAGTGAATGGAGCC
TCTTTGAAAGGACTATCTCAGCAGGAAGTCATATCTGCTCTCAGGGGAACTGCTCCAGAA
GTATTCTTGCTTCTCTGCAGACCTCCACCTGGTGTGCTACCGGAAATTGATACTGCGCTT
TTGACCCCACTTCAGTCTCCAGCACAAGTACTTCCAAACAGCAGTAAAGACTCTTCTCAG
CCATCATGTGTGGAGCAAAGCACCAGCTCAGATGAAAATGAAATGTCAGACAAAAGCAAA
AAACAGTGCAAGTCCCCATCCAGAAGAGACAGTTACAGTGACAGCAGTGGGAGTGGAGAA
GATGACTTAGTGACAGCTCCAGCAAACATATCAAATTCGACCTGGAGTTCAGCTTTGCAT
CAGACTCTAAGCAACATGGTATCACAGGCACAGAGTCATCATGAAGCACCCAAGAGTCAA
GAAGATACCATTTGTACCATGTTTTACTATCCTCAGAAAATTCCCAATAAACCAGAGTTT
GAGGACAGTAATCCTTCCCCTCTACCACCGGATATGGCTCCTGGGCAGAGTTATCAACCC
CAATCAGAATCTGCTTCCTCTAGTTCGATGGATAAGTATCATATACATCACATTTCTGAA
CCAACTAGACAAGAAAACTGGACACCTTTGAAAAATGACTTGGAAAATCACCTTGAAGAC
TTTGAACTGGAAGTAGAACTCCTCATTACCCTAATTAAATCAGAAAAAGGAAGCCTGGGT
TTTACAGTAACCAAAGGCAATCAGAGAATTGGTTGTTATGTTCATGATGTCATACAGGAT
CCAGCCAAAAGTGATGGAAGGCTAAAACCTGGGGACCGGCTCATAAAGGTTAATGATACA
GATGTTACTAATATGACTCATACAGATGCAGTTAATCTGCTCCGGGCTGCATCCAAAACA
GTCAGATTAGTTATTGGACGAGTTCTAGAATTACCCAGAATACCAATGTTGCCTCATTTG
CTACCGGACATAACACTAACGTGCAACAAAGAGGAGTTGGGTTTTTCCTTATGTGGAGGT
CATGACAGCCTTTATCAAGTGGTATATATTAGTGATATTAATCCAAGGTCCGTCGCAGCC
ATTGAGGGTAATCTCCAGCTATTAGATGTCATCCATTATGTGAACGGAGTCAGCACACAA
GGAATGACCTTGGAGGAAGTTAACAGAGCATTAGACATGTCACTTCCTTCATTGGTATTG
AAAGCAACAAGAAATGATCTTCCAGTGGTCCCCAGCTCAAAGAGGTCTGCTGTTTCAGCT
CCAAAGTCAACCAAAGGCAATGGTTCCTACAGTGTGGGGTCTTGCAGCCAGCCTGCCCTC
ACTCCTAATGATTCATTCTCCACGGTTGCTGGGGAAGAAATAAATGAAATATCGTACCCC
AAAGGAAAATGTTCTACTTATCAGATAAAGGGATCACCAAACTTGACTCTGCCCAAAGAA
TCTTATATACAAGAAGATGACATTTATGATGATTCCCAAGAAGCTGAAGTTATCCAGTCT
CTGCTGGATGTTGTGGATGAGGAAGCCCAGAATCTTTTAAACGAAAATAATGCAGCAGGA
TACTCCTGTGGTCCAGGTACATTAAAGATGAATGGGAAGTTATCAGAAGAGAGAACAGAA
GATACAGACTGCGATGGTTCACCTTTACCTGAGTATTTTACTGAGGCCACCAAAATGAAT
GGCTGTGAAGAATATTGTGAAGAAAAAGTAAAAAGTGAAAGCTTAATTCAGAAGCCACAA
GAAAAGAAGACTGATGATGATGAAATAACATGGGGAAATGATGAGTTGCCAATAGAGAGA
ACAAACCATGAAGATTCTGATAAAGATCATTCCTTTCTGACAAACGATGAGCTCGCTGTA
CTCCCTGTCGTCAAAGTGCTTCCCTCTGGTAAATACACGGGTGCCAACTTAAAATCAGTC
ATTCGAGTCCTGCGGGGTTTGCTAGATCAAGGAATTCCTTCTAAGGAGCTGGAGAATCTT
CAAGAATTAAAACCTTTGGATCAGTGTCTAATTGGGCAAACTAAGGAAAACAGAAGGAAG
AACAGATATAAAAATATACTTCCCTATGATGCTACAAGAGTGCCTCTTGGAGATGAAGGT
GGCTATATCAATGCCAGCTTCATTAAGATACCAGTTGGGAAAGAAGAGTTCGTTTACATT
GCCTGCCAAGGACCACTGCCTACAACTGTTGGAGACTTCTGGCAGATGATTTGGGAGCAA
AAATCCACAGTGATAGCCATGATGACTCAAGAAGTAGAAGGAGAAAAAATCAAATGCCAG
CGCTATTGGCCCAACATCCTAGGCAAAACAACAATGGTCAGCAACAGACTTCGACTGGCT
CTTGTGAGAATGCAGCAGCTGAAGGGCTTTGTGGTGAGGGCAATGACCCTTGAAGATATT
CAGACCAGAGAGGTGCGCCATATTTCTCATCTGAATTTCACTGCCTGGCCAGACCATGAT
ACACCTTCTCAACCAGATGATCTGCTTACTTTTATCTCCTACATGAGACACATCCACAGA
TCAGGCCCAATCATTACGCACTGCAGTGCTGGCATTGGACGTTCAGGGACCCTGATTTGC
ATAGATGTGGTTCTGGGATTAATCAGTCAGGATCTTGATTTTGACATCTCTGATTTGGTG
CGCTGCATGAGACTACAAAGACACGGAATGGTTCAGACAGAGGATCAATATATTTTCTGC
TATCAAGTCATCCTTTATGTCCTGACACGTCTTCAAGCAGAAGAAGAGCAAAAACAGCAG
CCTCAGCTTCTGAAGTGA
Protein Properties
Number of Residues 2485
Molecular Weight 274930.055
Theoretical pI 6.401
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Tyrosine-protein phosphatase non-receptor type 13
MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSLADPAALGFIISPWSLLLLP
SGSVSFTDENISNQDLRAFTAPEVLQNQSLTSLSDVEKIHIYSLGMTLYWGADYEVPQSQ
PIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKLVLGNL
SGTDQLSCNSEQKPDRSQAIRDRLRGKGLPTGRSSTSDVLDIQKPPLSHQTFLNKGLSKS
MGFLSIKDTQDENYFKDILSDNSGREDSENTFSPYQFKTSGPEKKPIPGIDVLSKKKIWA
SSMDLLCTADRDFSSGETATYRRCHPEAVTVRTSTTPRKKEARYSDGSIALDIFGPQKMD
PIYHTRELPTSSAISSALDRIRERQKKLQVLREAMNVEEPVRRYKTYHGDVFSTSSESPS
IISSESDFRQVRRSEASKRFESSSGLPGVDETLSQGQSQRPSRQYETPFEGNLINQEIML
KRQEEELMQLQAKMALRQSRLSLYPGDTIKASMLDITRDPLREIALETAMTQRKLRNFFG
PEFVKMTIEPFISLDLPRSILTKKGKNEDNRRKVNIMLLNGQRLELTCDTKTICKDVFDM
VVAHIGLVEHHLFALATLKDNEYFFVDPDLKLTKVAPEGWKEEPKKKTKATVNFTLFFRI
KFFMDDVSLIQHTLTCHQYYLQLRKDILEERMHCDDETSLLLASLALQAEYGDYQPEVHG
VSYFRMEHYLPARVMEKLDLSYIKEELPKLHNTYVGASEKETELEFLKVCQRLTEYGVHF
HRVHPEKKSQTGILLGVCSKGVLVFEVHNGVRTLVLRFPWRETKKISFSKKKITLQNTSD
GIKHGFQTDNSKICQYLLHLCSYQHKFQLQMRARQSNQDAQDIERASFRSLNLQAESVRG
FNMGRAISTGSLASSTLNKLAVRPLSVQAEILKRLSCSELSLYQPLQNSSKEKNDKASWE
EKPREMSKSYHDLSQASLYPHRKNVIVNMEPPPQTVAELVGKPSHQMSRSDAESLAGVTK
LNNSKSVASLNRSPERRKHESDSSSIEDPGQAYVLGMTMHSSGNSSSQVPLKENDVLHKR
WSIVSSPEREITLVNLKKDAKYGLGFQIIGGEKMGRLDLGIFISSVAPGGPADLDGCLKP
GDRLISVNSVSLEGVSHHAAIEILQNAPEDVTLVISQPKEKISKVPSTPVHLTNEMKNYM
KKSSYMQDSAIDSSSKDHHWSRGTLRHISENSFGPSGGLREGSLSSQDSRTESASLSQSQ
VNGFFASHLGDQTWQESQHGSPSPSVISKATEKETFTDSNQSKTKKPGISDVTDYSDRGD
SDMDEATYSSSQDHQTPKQESSSSVNTSNKMNFKTFSSSPPKPGDIFEVELAKNDNSLGI
SVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRN
TGQVVHLLLEKGQSPTSKEHVPVTPQCTLSDQNAQGQGPEKVKKTTQVKDYSFVTEENTF
EVKLFKNSSGLGFSFSREDNLIPEQINASIVRVKKLFPGQPAAESGKIDVGDVILKVNGA
SLKGLSQQEVISALRGTAPEVFLLLCRPPPGVLPEIDTALLTPLQSPAQVLPNSSKDSSQ
PSCVEQSTSSDENEMSDKSKKQCKSPSRRDSYSDSSGSGEDDLVTAPANISNSTWSSALH
QTLSNMVSQAQSHHEAPKSQEDTICTMFYYPQKIPNKPEFEDSNPSPLPPDMAPGQSYQP
QSESASSSSMDKYHIHHISEPTRQENWTPLKNDLENHLEDFELEVELLITLIKSEKGSLG
FTVTKGNQRIGCYVHDVIQDPAKSDGRLKPGDRLIKVNDTDVTNMTHTDAVNLLRAASKT
VRLVIGRVLELPRIPMLPHLLPDITLTCNKEELGFSLCGGHDSLYQVVYISDINPRSVAA
IEGNLQLLDVIHYVNGVSTQGMTLEEVNRALDMSLPSLVLKATRNDLPVVPSSKRSAVSA
PKSTKGNGSYSVGSCSQPALTPNDSFSTVAGEEINEISYPKGKCSTYQIKGSPNLTLPKE
SYIQEDDIYDDSQEAEVIQSLLDVVDEEAQNLLNENNAAGYSCGPGTLKMNGKLSEERTE
DTDCDGSPLPEYFTEATKMNGCEEYCEEKVKSESLIQKPQEKKTDDDEITWGNDELPIER
TNHEDSDKDHSFLTNDELAVLPVVKVLPSGKYTGANLKSVIRVLRGLLDQGIPSKELENL
QELKPLDQCLIGQTKENRRKNRYKNILPYDATRVPLGDEGGYINASFIKIPVGKEEFVYI
ACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRYWPNILGKTTMVSNRLRLA
LVRMQQLKGFVVRAMTLEDIQTREVRHISHLNFTAWPDHDTPSQPDDLLTFISYMRHIHR
SGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQRHGMVQTEDQYIFC
YQVILYVLTRLQAEEEQKQQPQLLK
GenBank ID Protein 18375646
UniProtKB/Swiss-Prot ID Q12923
UniProtKB/Swiss-Prot Entry Name PTN13_HUMAN
PDB IDs
GenBank Gene ID NM_080683.2
GeneCard ID PTPN13
GenAtlas ID PTPN13
HGNC ID HGNC:9646
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  3. Irie S, Hachiya T, Rabizadeh S, Maruyama W, Mukai J, Li Y, Reed JC, Bredesen DE, Sato TA: Functional interaction of Fas-associated phosphatase-1 (FAP-1) with p75(NTR) and their effect on NF-kappaB activation. FEBS Lett. 1999 Oct 29;460(2):191-8. [PubMed:10544233 ]
  4. Banville D, Ahmad S, Stocco R, Shen SH: A novel protein-tyrosine phosphatase with homology to both the cytoskeletal proteins of the band 4.1 family and junction-associated guanylate kinases. J Biol Chem. 1994 Sep 2;269(35):22320-7. [PubMed:8071359 ]
  5. Maekawa K, Imagawa N, Nagamatsu M, Harada S: Molecular cloning of a novel protein-tyrosine phosphatase containing a membrane-binding domain and GLGF repeats. FEBS Lett. 1994 Jan 10;337(2):200-6. [PubMed:8287977 ]
  6. Saras J, Claesson-Welsh L, Heldin CH, Gonez LJ: Cloning and characterization of PTPL1, a protein tyrosine phosphatase with similarities to cytoskeletal-associated proteins. J Biol Chem. 1994 Sep 30;269(39):24082-9. [PubMed:7929060 ]
  7. Sato T, Irie S, Kitada S, Reed JC: FAP-1: a protein tyrosine phosphatase that associates with Fas. Science. 1995 Apr 21;268(5209):411-5. [PubMed:7536343 ]
  8. Honda H, Shibuya M, Chiba S, Yazaki Y, Hirai H: Identification of novel protein-tyrosine phosphatases in a human leukemia cell line, F-36P. Leukemia. 1993 May;7(5):742-6. [PubMed:8483328 ]
  9. Saras J, Franzen P, Aspenstrom P, Hellman U, Gonez LJ, Heldin CH: A novel GTPase-activating protein for Rho interacts with a PDZ domain of the protein-tyrosine phosphatase PTPL1. J Biol Chem. 1997 Sep 26;272(39):24333-8. [PubMed:9305890 ]
  10. Murthy KK, Clark K, Fortin Y, Shen SH, Banville D: ZRP-1, a zyxin-related protein, interacts with the second PDZ domain of the cytosolic protein tyrosine phosphatase hPTP1E. J Biol Chem. 1999 Jul 16;274(29):20679-87. [PubMed:10400701 ]
  11. Kimber WA, Deak M, Prescott AR, Alessi DR: Interaction of the protein tyrosine phosphatase PTPL1 with the PtdIns(3,4)P2-binding adaptor protein TAPP1. Biochem J. 2003 Dec 1;376(Pt 2):525-35. [PubMed:14516276 ]
  12. Kozlov G, Gehring K, Ekiel I: Solution structure of the PDZ2 domain from human phosphatase hPTP1E and its interactions with C-terminal peptides from the Fas receptor. Biochemistry. 2000 Mar 14;39(10):2572-80. [PubMed:10704206 ]
  13. Kozlov G, Banville D, Gehring K, Ekiel I: Solution structure of the PDZ2 domain from cytosolic human phosphatase hPTP1E complexed with a peptide reveals contribution of the beta2-beta3 loop to PDZ domain-ligand interactions. J Mol Biol. 2002 Jul 19;320(4):813-20. [PubMed:12095257 ]
  14. Villa F, Deak M, Bloomberg GB, Alessi DR, van Aalten DM: Crystal structure of the PTPL1/FAP-1 human tyrosine phosphatase mutated in colorectal cancer: evidence for a second phosphotyrosine substrate recognition pocket. J Biol Chem. 2005 Mar 4;280(9):8180-7. Epub 2004 Dec 20. [PubMed:15611135 ]
  15. Yoshida S, Harada H, Nagai H, Fukino K, Teramoto A, Emi M: Head-to-head juxtaposition of Fas-associated phosphatase-1 (FAP-1) and c-Jun NH2-terminal kinase 3 (JNK3) genes: genomic structure and seven polymorphisms of the FAP-1 gene. J Hum Genet. 2002;47(11):614-9. [PubMed:12436199 ]