You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08930
Secondary Accession Numbers
  • 14659
Name Tyrosine-protein phosphatase non-receptor type 18
Synonyms
  1. Brain-derived phosphatase
Gene Name PTPN18
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function Differentially dephosphorylate autophosphorylated tyrosine kinases which are known to be overexpressed in tumor tissues.
Pathways Not Available
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
GO Classification
Cellular Component
cytoplasm
nucleus
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
Molecular Function
non-membrane spanning protein tyrosine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location 2
Locus 2q21.1
SNPs PTPN18
Gene Sequence
>1377 bp
ATGAGCCGCAGCCTGGACTCGGCGCGGAGCTTCCTGGAGCGGCTGGAAGCGCGGGGCGGC
CGGGAGGGGGCAGTCCTCGCCGGCGAGTTCAGCGACATCCAGGCCTGCTCGGCCGCCTGG
AAGGCTGACGGCGTGTGCTCCACCGTGGCCGGCAGTCGGCCAGAGAACGTGAGGAAGAAC
CGCTACAAAGACGTGCTGCCTTATGATCAGACGCGAGTAATCCTCTCCCTGCTCCAGGAA
GAGGGACACAGCGACTACATTAATGGCAACTTCATCCGGGGCGTGGATGGAAGCCTGGCC
TACATTGCCACGCAAGGACCCTTGCCTCACACCCTGCTAGACTTCTGGAGACTGGTCTGG
GAGTTTGGGGTCAAGGTGATCCTGATGGCCTGTCGAGAGATAGAGAATGGGCGGAAAAGG
TGTGAGCGGTACTGGGCCCAGGAGCAGGAGCCACTGCAGACTGGGCTTTTCTGCATCACT
CTGATAAAGGAGAAGTGGCTGAATGAGGACATCATGCTCAGGACCCTCAAGGTCACATTC
CAGAAGGAGTCCCGTTCTGTGTACCAGCTACAGTATATGTCCTGGCCAGACCGTGGGGTC
CCCAGCAGTCCTGACCACATGCTCGCCATGGTGGAGGAAGCCCGTCGCCTCCAGGGATCT
GGCCCTGAACCCCTCTGTGTCCACTGCAGTGCGGGTTGTGGGCGAACAGGCGTCCTGTGC
ACCGTGGATTATGTGAGGCAGCTGCTCCTGACCCAGATGATCCCACCTGACTTCAGTCTC
TTTGATGTGGTCCTTAAGATGAGGAAGCAGCGGCCTGCGGCCGTGCAGACAGAGGAGCAG
TACAGGTTCCTGTACCACACGGTGGCTCAGATGTTCTGCTCCACACTCCAGAATGCCAGC
CCCCACTACCAGAACATCAAAGAGAATTGTGCCCCACTCTACGACGATGCCCTCTTCCTC
CGGACTCCCCAGGCACTTCTCGCCATACCCCGCCCACCAGGAGGGGTCCTCAGGAGCATC
TCTGTGCCCGGGTCCCCGGGCCACGCCATGGCTGACACCTACGCGGAGGAGCAGAAGCGC
GGGGCTCCAGCGGGCGCCGGGAGTGGGACGCAGACGGGGACGGGGACGGGGGCGCGCAGC
GCGGAGGAGGCGCCGCTCTACAGCAAGGTGACGCCGCGCGCCCAGCGACCCGGGGCGCAC
GCGGAGGACGCGAGGGGGACGCTGCCTGGCCGCGTTCCTGCTGACCAAAGTCCTGCCGGA
TCTGGCGCCTACGAGGACGTGGCGGGTGGAGCTCAGACCGGTGGGCTAGGTTTCAACCTG
CGCATTGGGAGGCCGAAGGGTCCCCGGGACCCGCCTGCTGAGTGGACCCGGGTGTAA
Protein Properties
Number of Residues 460
Molecular Weight 38475.43
Theoretical pI 8.591
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Tyrosine-protein phosphatase non-receptor type 18
MSRSLDSARSFLERLEARGGREGAVLAGEFSDIQACSAAWKADGVCSTVAGSRPENVRKN
RYKDVLPYDQTRVILSLLQEEGHSDYINGNFIRGVDGSLAYIATQGPLPHTLLDFWRLVW
EFGVKVILMACREIENGRKRCERYWAQEQEPLQTGLFCITLIKEKWLNEDIMLRTLKVTF
QKESRSVYQLQYMSWPDRGVPSSPDHMLAMVEEARRLQGSGPEPLCVHCSAGCGRTGVLC
TVDYVRQLLLTQMIPPDFSLFDVVLKMRKQRPAAVQTEEQYRFLYHTVAQMFCSTLQNAS
PHYQNIKENCAPLYDDALFLRTPQALLAIPRPPGGVLRSISVPGSPGHAMADTYAVVQKR
GAPAGAGSGTQTGTGTGTGARSAEEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSP
AGSGAYEDVAGGAQTGGLGFNLRIGRPKGPRDPPAEWTRV
GenBank ID Protein 1871531
UniProtKB/Swiss-Prot ID Q99952
UniProtKB/Swiss-Prot Entry Name PTN18_HUMAN
PDB IDs
GenBank Gene ID X79568
GeneCard ID PTPN18
GenAtlas ID PTPN18
HGNC ID HGNC:9649
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]
  3. Zhang Y, Wolf-Yadlin A, Ross PL, Pappin DJ, Rush J, Lauffenburger DA, White FM: Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules. Mol Cell Proteomics. 2005 Sep;4(9):1240-50. Epub 2005 Jun 11. [PubMed:15951569 ]
  4. Heibeck TH, Ding SJ, Opresko LK, Zhao R, Schepmoes AA, Yang F, Tolmachev AV, Monroe ME, Camp DG 2nd, Smith RD, Wiley HS, Qian WJ: An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells. J Proteome Res. 2009 Aug;8(8):3852-61. doi: 10.1021/pr900044c. [PubMed:19534553 ]
  5. Tao WA, Wollscheid B, O'Brien R, Eng JK, Li XJ, Bodenmiller B, Watts JD, Hood L, Aebersold R: Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry. Nat Methods. 2005 Aug;2(8):591-8. [PubMed:16094384 ]
  6. Wolf-Yadlin A, Hautaniemi S, Lauffenburger DA, White FM: Multiple reaction monitoring for robust quantitative proteomic analysis of cellular signaling networks. Proc Natl Acad Sci U S A. 2007 Apr 3;104(14):5860-5. Epub 2007 Mar 26. [PubMed:17389395 ]
  7. Barr AJ, Ugochukwu E, Lee WH, King ON, Filippakopoulos P, Alfano I, Savitsky P, Burgess-Brown NA, Muller S, Knapp S: Large-scale structural analysis of the classical human protein tyrosine phosphatome. Cell. 2009 Jan 23;136(2):352-63. doi: 10.1016/j.cell.2008.11.038. [PubMed:19167335 ]
  8. Kim YW, Wang H, Sures I, Lammers R, Martell KJ, Ullrich A: Characterization of the PEST family protein tyrosine phosphatase BDP1. Oncogene. 1996 Nov 21;13(10):2275-9. [PubMed:8950995 ]