You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08935
Secondary Accession Numbers
  • 14664
Name Tyrosine-protein phosphatase non-receptor type 3
Synonyms
  1. PTP-H1
  2. Protein-tyrosine phosphatase H1
Gene Name PTPN3
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function May act at junctions between the membrane and the cytoskeleton. Possesses tyrosine phosphatase activity.
Pathways Not Available
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
GO Classification
Biological Process
negative regulation of membrane protein ectodomain proteolysis
negative regulation of mitotic cell cycle
Cellular Component
cytoskeleton
cytoplasm
internal side of plasma membrane
Component
cell part
intracellular part
cytoplasm
cytoskeleton
membrane part
organelle
extrinsic to membrane
non-membrane-bounded organelle
intracellular non-membrane-bounded organelle
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
protein binding
cytoskeletal protein binding
Molecular Function
protein tyrosine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Cell membrane
  2. Cytoplasm
  3. Peripheral membrane protein
  4. Cytoplasmic side
  5. cytoskeleton
Gene Properties
Chromosome Location 9
Locus 9q31
SNPs PTPN3
Gene Sequence
>2742 bp
ATGACCTCCCGGTTACGTGCGTTGGGTGGAAGAATTAATAATATACGCACCTCGGAGTTA
CCCAAAGAGAAAACTCGATCAGAAGTCATTTGCAGCATCCACTTTTTAGATGGCGTGGTA
CAGACCTTTAAAGTTACTAAACAAGACACTGGCCAGGTTCTTCTGGATATGGTGCACAAC
CACCTGGGTGTGACTGAAAAGGAATATTTTGGTTTACAGCATGATGACGACTCCGTGGAC
TCTCCTAGATGGCTGGAAGCAAGCAAAGCCATCAGGAAGCAGTTAAAAGGAGGTTTCCCC
TGTACCCTGCATTTTCGAGTAAGATTTTTTATACCTGATCCCAACACACTGCAGCAAGAA
CAAACCAGGCACTTGTATTTCTTACAACTGAAGATGGATATTTGCGAAGGAAGGTTAACC
TGCCCTCTTAACTCAGCAGTGGTTCTAGCGTCCTATGCCGTACAATCTCATTTTGGAGAC
TATAATTCTTCCATACATCATCCAGGCTATCTTTCCGATAGTCACTTTATACCCGATCAA
AATGAGGACTTTTTAACAAAAGTCGAATCTCTGCATGAGCAGCACAGTGGGCTAAAACAA
TCAGAAGCAGAATCCTGCTATATCAACATAGCGCGGACCCTCGACTTCTATGGAGTAGAA
CTGCACAGTGGTAGGGATCTGCACAATTTAGACCTAATGATTGGAATTGCTTCCGCGGGT
GTTGCTGTGTACCGAAAATACATTTGCACAAGTTTCTATCCTTGGGTGAACATTCTCAAA
ATTTCTTTCAAAAGGAAAAAGTTCTTCATACATCAGCGACAGAAACAGGCTGAATCCAGG
GAACATATTGTGGCCTTCAACATGCTGAATTACCGATCTTGCAAAAACTTGTGGAAATCC
TGTGTTGAGCACCATACGTTCTTTCAGGCAAAGAAGCTACTACCTCAGGAAAAGAATGTT
CTGTCTCAGTACTGGACTATGGGCTCTCGGAACACCAAAAAGTCGGTAAATAACCAATAT
TGCAAAAAGGTGATTGGCGGGATGGTGTGGAACCCAGCCATGCGGAGATCCTTATCAGTG
GAGCACTTAGAAACCAAGAGTCTGCCTTCTCGTTCCCCTCCCATTACTCCCAACTGGCGA
AGTCCTCGGCTCCGGCACGAAATCCGAAAGCCACGCCACTCTTCTGCAGATAACCTTGCA
AATGAAATGACCTACATCACGGAAACGGAAGATGTATTTTACACGTACAAGGGCTCTCTG
GCCCCTCAAGACAGCGATTCTGAAGTTTCTCAGAACCGAAGCCCGCACCAAGAGAGTTTA
TCCGAGAACAATCCGGCACAAAGCTACCTGACCCAGAAGTCATCCAGTTCTGTGTCTCCA
TCTTCAAATGCTCCAGGCTCCTGCTCACCTGACGGCGTTGATCAGCAGCTCTTAGATGAC
TTCCACAGGGTGACCAAAGGGGGCTCCACCGAGGACGCCAGCCAGTACTACTGTGACAAG
AATGATAATGGTGACAGCTACTTAGTCTTGATCCGTATCACACCAGATGAAGATGGAAAA
TTTGGATTTAATCTTAAGGGAGGAGTGGATCAAAAGATGCCTCTTGTGGTATCAAGGATA
AACCCAGAGTCACCTGCGGACACCTGCATTCCTAAGCTGAACGAAGGGGATCAAATCGTG
TTAATCAATGGCCGGGACATCTCAGAACACACGCATGACCAAGTGGTGATGTTCATCAAA
GCCAGCCGGGAGTCCCACTCACGGGAGCTGGCCCTGGTGATCAGGAGGAGAGCTGTCCGC
TCATTTGCTGACTTCAAGTCTGAAGATGAACTGAACCAGCTTTTCCCCGAAGCCATTTTC
CCCATGTGTCCGGAGGGTGGGGACACTTTGGAGGGATCCATGGCACAGCTAAAGAAGGGC
CTCGAAAGCGGGACGGTGCTGATCCAGTTTGAGCAACTCTACAGAAAAAAGCCAGGTTTG
GCCATCACGTTTGCAAAGCTGCCTCAAAATTTGGACAAAAACCGATATAAAGATGTGCTG
CCTTATGACACCACCCGGGTATTATTGCAGGGAAATGAAGATTATATTAATGCAAGTTAC
GTGAACATGGAAATTCCTGCTGCTAACCTTGTGAACAAGTACATCGCCACTCAGGGGCCC
CTGCCGCATACCTGTGCACAGTTTTGGCAGGTTGTCTGGGATCAGAAGTTGTCACTCATT
GTCATGTTGACGACTCTCACAGAACGAGGGCGGACCAAATGTCACCAGTACTGGCCAGAT
CCCCCCGACGTCATGAACCACGGCGGCTTTCACATCCAGTGTCAGTCAGAGGACTGCACC
ATCGCCTATGTGTCCCGAGAAATGCTGGTCACAAACACCCAGACCGGGGAAGAACACACA
GTGACACATCTCCAGTACGTCGCATGGCCTGACCACGGTGTGCCCGATGACTCCTCCGAC
TTTCTGGAATTTGTAAACTATGTGAGGTCTCTGAGAGTGGACAGCGAGCCCGTCCTAGTT
CACTGCAGTGCTGGAATAGGTCGAACCGGTGTGTTGGTCACTATGGAAACAGCCATGTGC
CTAACTGAGAGGAACCTGCCCATTTACCCACTGGATATTGTCCGAAAAATGCGAGACCAG
CGCGCCATGATGGTGCAGACATCAAGCCAGTACAAGTTTGTGTGTGAAGCGATTCTTCGT
GTGTATGAAGAAGGTTTAGTCCAAATGCTGGATCCTAGTTAA
Protein Properties
Number of Residues 913
Molecular Weight 98897.235
Theoretical pI 6.798
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Tyrosine-protein phosphatase non-receptor type 3
MTSRLRALGGRINNIRTSELPKEKTRSEVICSIHFLDGVVQTFKVTKQDTGQVLLDMVHN
HLGVTEKEYFGLQHDDDSVDSPRWLEASKAIRKQLKGGFPCTLHFRVRFFIPDPNTLQQE
QTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSDSHFIPDQ
NEDFLTKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHSGRDLHNLDLMIGIASAG
VAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKS
CVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNTKKSVNNQYCKKVIGGMVWNPAMRRSLSV
EHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSL
APQDSDSEVSQNRSPHQESLSENNPAQSYLTQKSSSSVSPSSNAPGSCSPDGVDQQLLDD
FHRVTKGGSTEDASQYYCDKNDNGDSYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRI
NPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRRAVR
SFADFKSEDELNQLFPEAIFPMCPEGGDTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGL
AITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGP
LPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGFHIQCQSEDCT
IAYVSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDSEPVLV
HCSAGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILR
VYEEGLVQMLDPS
GenBank ID Protein 223941876
UniProtKB/Swiss-Prot ID P26045
UniProtKB/Swiss-Prot Entry Name PTN3_HUMAN
PDB IDs
GenBank Gene ID NM_002829
GeneCard ID PTPN3
GenAtlas ID PTPN3
HGNC ID HGNC:9655
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  4. Barr AJ, Ugochukwu E, Lee WH, King ON, Filippakopoulos P, Alfano I, Savitsky P, Burgess-Brown NA, Muller S, Knapp S: Large-scale structural analysis of the classical human protein tyrosine phosphatome. Cell. 2009 Jan 23;136(2):352-63. doi: 10.1016/j.cell.2008.11.038. [PubMed:19167335 ]
  5. Yang Q, Tonks NK: Isolation of a cDNA clone encoding a human protein-tyrosine phosphatase with homology to the cytoskeletal-associated proteins band 4.1, ezrin, and talin. Proc Natl Acad Sci U S A. 1991 Jul 15;88(14):5949-53. [PubMed:1648725 ]
  6. Arimura Y, Hinoda Y, Itoh F, Takekawa M, Tsujisaki M, Adachi M, Imai K, Yachi A: cDNA cloning of new protein tyrosine phosphatases in the human colon. Tumour Biol. 1992;13(3):180-6. [PubMed:1626183 ]
  7. Ikuta S, Itoh F, Hinoda Y, Toyota M, Makiguchi Y, Imai K, Yachi A: Expression of cytoskeletal-associated protein tyrosine phosphatase PTPH1 mRNA in human hepatocellular carcinoma. J Gastroenterol. 1994 Dec;29(6):727-32. [PubMed:7874267 ]