Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08936
Secondary Accession Numbers
  • 14665
Name Tyrosine-protein phosphatase non-receptor type 4
Synonyms
  1. MEG
  2. PTPase-MEG1
  3. Protein-tyrosine phosphatase MEG1
Gene Name PTPN4
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function May act at junctions between the membrane and the cytoskeleton.
Pathways Not Available
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
GO Classification
Cellular Component
cytoskeleton
cytoplasm
internal side of plasma membrane
Component
cell part
intracellular part
cytoplasm
cytoskeleton
membrane part
organelle
extrinsic to membrane
non-membrane-bounded organelle
intracellular non-membrane-bounded organelle
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
protein binding
cytoskeletal protein binding
Molecular Function
non-membrane spanning protein tyrosine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Cell membrane
  2. Cytoplasm
  3. Peripheral membrane protein
  4. Cytoplasmic side
  5. cytoskeleton
Gene Properties
Chromosome Location 2
Locus 2q14.2
SNPs PTPN4
Gene Sequence
>2781 bp
ATGACCTCACGTTTCCGATTGCCTGCTGGCAGAACCTACAATGTACGAGCATCAGAGTTG
GCCCGAGACAGACAGCATACTGAAGTGGTTTGCAACATCCTTCTTCTGGATAACACTGTA
CAAGCTTTCAAAGTCAATAAACATGATCAGGGGCAAGTCTTGTTGGATGTCGTCTTCAAG
CATCTAGATTTGACTGAGCAGGACTATTTTGGTTTACAGTTGGCTGATGATTCCACAGAT
AACCCAAGGTGGCTGGATCCAAACAAACCAATAAGGAAGCAGCTAAAGAGAGGATCTCCT
TACAGTTTGAACTTTAGAGTCAAATTTTTTGTAAGTGACCCCAACAAGTTACAAGAAGAA
TATACAAGGTACCAGTATTTTTTGCAAATTAAACAAGACATTCTTACTGGAAGATTACCC
TGTCCTTCTAATACTGCTGCCCTTTTAGCTTCATTTGCTGTTCAGTCTGAACTTGGAGAC
TACGATCAGTCAGAGAACTTGTCAGGCTACCTCTCAGATTATTCTTTCATTCCTAATCAA
CCTCAAGATTTTGAAAAAGAAATTGCAAAATTACATCAGCAACACATAGGCTTATCTCCT
GCAGAAGCAGAATTTAATTACCTAAACACAGCACGTACCTTAGAACTCTATGGAGTTGAA
TTCCACTATGCAAGGGATCAGAGTAACAATGAAATTATGATTGGAGTGATGTCAGGAGGA
ATTCTGATTTATAAGAACAGGGTACGAATGAATACCTTTCCATGGTTGAAGATTGTAAAA
ATTTCTTTTAAGTGCAAACAGTTTTTTATTCAACTTAGAAAAGAATTGCATGAATCTAGA
GAAACATTATTGGGATTTAATATGGTGAATTACAGAGCATGTAAAAATTTGTGGAAAGCA
TGTGTAGAACATCACACATTCTTCCGTTTGGACAGACCACTTCCACCTCAAAAGAATTTT
TTTGCACATTATTTTACATTAGGTTCAAAATTCCGGTACTGTGGGAGAACTGAAGTCCAA
TCAGTTCAGTATGGCAAAGAAAAGGCAAATAAAGACAGGGTATTTGCAAGATCCCCAAGT
AAGCCCTTGGCACGGAAATTAATGGATTGGGAAGTAGTAAGCAGAAATTCAATATCTGAT
GACAGGTTAGAAACACAAAGTCTTCCATCACGATCTCCACCGGGAACTCCTAATCATCGA
AATTCTACATTCACGCAGGAAGGAACCCGGTTACGACCATCTTCAGTTGGTCATTTGGTA
GACCATATGGTTCATACTTCCCCAAGCGAAGTGTTTGTAAATCAGAGATCTCCGTCATCA
ACACAAGCTAATAGCATTGTTCTGGAATCATCACCATCACAAGAGACCCCTGGAGATGGG
AAGCCTCCAGCTTTACCACCCAAACAGTCAAAGAAAAACAGTTGGAACCAAATTCATTAT
TCACATTCGCAACAAGATCTAGAAAGTCATATTAATGAAACATTTGATATTCCATCTTCT
CCTGAAAAACCCACTCCTAATGGTGGTATTCCACATGATAATCTTGTCCTAATCAGAATG
AAACCTGATGAAAATGGGAGGTTTGGATTCAATGTAAAGGGAGGATATGATCAGAAGATG
CCTGTGATTGTGTCTCGAGTAGCACCAGGAACACCTGCTGACCTCTGTGTCCCTAGACTG
AATGAAGGGGACCAAGTTGTACTGATCAATGGTCGGGACATTGCAGAACACACTCATGAT
CAGGTTGTGCTGTTTATTAAAGCTAGTTGTGAGAGACATTCTGGGGAACTCATGCTTCTA
GTTCGACCTAATGCTGTATATGATGTAGTGGAAGAAAAGCTAGAAAATGAGCCAGATTTC
CAGTATATTCCTGAGAAAGCCCCACTAGATAGTGTGCATCAGGATGACCATTCCCTGCGG
GAGTCAATGATCCAGCTAGCTGAGGGGCTTATCACTGGAACAGTCCTGACACAGTTTGAT
CAACTGTATCGGAAAAAACCTGGAATGACAATGTCCTGTGCCAAATTACCTCAGAATATT
TCCAAAAATAGATACAGAGATATTTCGCCTTATGATGCCACACGGGTCATTTTAAAAGGT
AATGAAGACTACATCAATGCGAACTATATAAATATGGAAATTCCTTCTTCCAGCATTATA
AATCAGTACATTGCTTGTCAAGGGCCATTACCACACACTTGTACAGATTTTTGGCAGATG
ACTTGGGAACAAGGCTCCTCTATGGTTGTAATGTTGACCACACAAGTTGAACGTGGCAGA
GTTAAATGTCACCAATATTGGCCAGAACCCACAGGCAGTTCATCTTATGGATGCTACCAA
GTTACCTGCCACTCTGAAGAAGGAAACACTGCCTATATCTTCAGGAAGATGACCCTATTT
AACCAAGAGAAAAATGAAAGTCGTCCACTCACTCAGATCCAGTACATAGCCTGGCCTGAC
CATGGAGTCCCTGATGATTCGAGTGACTTTCTAGATTTTGTTTGTCATGTACGAAACAAG
AGGGCTGGCAAGGAAGAACCCGTTGTTGTCCATTGCAGTGCTGGAATCGGAAGAACTGGG
GTTCTTATTACTATGGAAACAGCCATGTGTCTCATTGAATGCAATCAGCCAGTTTATCCA
CTAGATATTGTAAGAACAATGAGAGATCAGCGAGCCATGATGATCCAAACACCTAGTCAA
TACAGATTTGTATGTGAAGCTATTTTGAAAGTTTATGAAGAAGGCTTTGTTAAACCCTTA
ACAACATCAACAAATAAATAA
Protein Properties
Number of Residues 926
Molecular Weight 105910.315
Theoretical pI 7.451
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Tyrosine-protein phosphatase non-receptor type 4
MTSRFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTVQAFKVNKHDQGQVLLDVVFK
HLDLTEQDYFGLQLADDSTDNPRWLDPNKPIRKQLKRGSPYSLNFRVKFFVSDPNKLQEE
YTRYQYFLQIKQDILTGRLPCPSNTAALLASFAVQSELGDYDQSENLSGYLSDYSFIPNQ
PQDFEKEIAKLHQQHIGLSPAEAEFNYLNTARTLELYGVEFHYARDQSNNEIMIGVMSGG
ILIYKNRVRMNTFPWLKIVKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKNLWKA
CVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKEKANKDRVFARSPS
KPLARKLMDWEVVSRNSISDDRLETQSLPSRSPPGTPNHRNSTFTQEGTRLRPSSVGHLV
DHMVHTSPSEVFVNQRSPSSTQANSIVLESSPSQETPGDGKPPALPPKQSKKNSWNQIHY
SHSQQDLESHINETFDIPSSPEKPTPNGGIPHDNLVLIRMKPDENGRFGFNVKGGYDQKM
PVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELMLL
VRPNAVYDVVEEKLENEPDFQYIPEKAPLDSVHQDDHSLRESMIQLAEGLITGTVLTQFD
QLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILKGNEDYINANYINMEIPSSSII
NQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPTGSSSYGCYQ
VTCHSEEGNTAYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDSSDFLDFVCHVRNK
RAGKEEPVVVHCSAGIGRTGVLITMETAMCLIECNQPVYPLDIVRTMRDQRAMMIQTPSQ
YRFVCEAILKVYEEGFVKPLTTSTNK
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P29074
UniProtKB/Swiss-Prot Entry Name PTN4_HUMAN
PDB IDs
GenBank Gene ID M68941
GeneCard ID PTPN4
GenAtlas ID PTPN4
HGNC ID HGNC:9656
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Honda H, Shibuya M, Chiba S, Yazaki Y, Hirai H: Identification of novel protein-tyrosine phosphatases in a human leukemia cell line, F-36P. Leukemia. 1993 May;7(5):742-6. [PubMed:8483328 ]
  4. Gu MX, York JD, Warshawsky I, Majerus PW: Identification, cloning, and expression of a cytosolic megakaryocyte protein-tyrosine-phosphatase with sequence homology to cytoskeletal protein 4.1. Proc Natl Acad Sci U S A. 1991 Jul 1;88(13):5867-71. [PubMed:1648233 ]