Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08938
Secondary Accession Numbers
  • 14667
Name Tyrosine-protein phosphatase non-receptor type 9
Synonyms
  1. PTPase MEG2
  2. Protein-tyrosine phosphatase MEG2
Gene Name PTPN9
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function Protein-tyrosine phosphatase that could participate in the transfer of hydrophobic ligands or in functions of the Golgi apparatus.
Pathways Not Available
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
GO Classification
Cellular Component
cytoplasmic part
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
Molecular Function
non-membrane spanning protein tyrosine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Cytoplasm (Probable)
Gene Properties
Chromosome Location 15
Locus 15q24.2
SNPs PTPN9
Gene Sequence
>1782 bp
ATGGAGCCCGCGACCGCGCCCCGGCCCGACATGGCGCCGGAGCTGACCCCGGAGGAGGAG
CAGGCTACCAAGCAGTTTCTCGAAGAGATTAACAAGTGGACAGTTCAGTACAATGTTTCC
CCGCTGTCTTGGAATGTGGCTGTCAAGTTCCTCATGGCAAGGAAGTTTGATGTGCTCCGT
GCCATAGAATTGTTCCACTCCTACAGAGAAACTCGAAGGAAGGAAGGCATTGTAAAGCTG
AAACCTCATGAGGAACCTCTTCGTTCTGAGATCCTCAGTGGAAAATTCACCATCTTAAAT
GTTCGGGACCCAACAGGAGCCTCCATTGCCCTCTTTACTGCCAGGTTGCATCATCCCCAC
AAGTCAGTCCAACATGTGGTACTTCAGGCTCTGTTTTACTTGCTAGACAGAGCTGTGGAT
AGCTTTGAAACTCAGAGGAATGGACTGGTGTTTATCTATGACATGTGTGGTTCTAATTAT
GCCAACTTTGAGCTGGATCTTGGCAAGAAAGTCCTAAACCTGCTGAAGGGAGCATTTCCA
GCTCGTTTGAAGAAGGTGCTGATTGTGGGGGCACCCATATGGTTCCGAGTGCCCTATTCC
ATCATCAGTCTCCTCCTGAAGGACAAAGTCCGGGAGAGGATTCAAATATTAAAGACATCT
GAGGTCACGCAGCATCTGCCCAGGGAGTGTCTTCCAGAAAACCTGGGTGGGTACGTCAAA
ATTGATCTCGCCACTTGGAATTTCCAGTTCCTACCCCAGGTGAACGGCCACCCAGATCCC
TTCGATGAGATCATCCTGTTCTCCCTCCCTCCTGCCTTAGACTGGGACTCAGTACATGTT
CCAGGTCCCCATGCTATGACCATCCAAGAGTTGGTGGACTATGTTAATGCCAGGCAAAAG
CAAGGAATCTATGAGGAATATGAAGACATTCGTCGTGAGAACCCTGTTGGCACTTTCCAC
TGTTCCATGTCTCCAGGAAACCTAGAGAAAAACCGTTATGGGGATGTACCCTGCCTGGAC
CAAACTAGAGTGAAGCTAACAAAGCGAAGTGGCCATACTCAGACAGATTACATCAATGCC
AGTTTCATGGATGGCTACAAGCAGAAGAATGCTTACATTGGCACACAAGGTCCTTTGGAG
AATACCTATCGTGATTTCTGGCTCATGGTATGGGAGCAAAAAGTCTTGGTGATTGTCATG
ACCACCCGCTTTGAGGAAGGCGGCAGGAGAAAGTGTGGCCAGTACTGGCCTTTAGAAAAA
GACTCTCGGATCCGATTTGGCTTCCTCACAGTGACCAATCTAGGCGTGGAGAACATGAAT
CATTATAAGAAAACAACGCTAGAAATTCACAACACAGAGGAACGGCAGAAACGCCAGGTG
ACCCACTTCCAGTTCTTGAGCTGGCCAGACTATGGTGTCCCTTCCTCAGCAGCTTCCCTC
ATTGACTTCTTGAGAGTGGTCAGAAACCAGCAGAGTCTGGCTGTGAGCAACATGGGAGCA
CGCTCCAAAGGGCAGTGCCCTGAGCCACCCATTGTGGTCCATTGCAGTGCAGGCATTGGC
AGGACAGGTACCTTCTGCTCACTGGACATCTGCCTGGCACAGCTGGAGGAGCTTGGCACC
CTTAATGTGTTCCAGACGGTGTCACGCATGAGGACCCAGAGGGCCTTCAGCATCCAGACC
CCTGAGCAGTACTATTTTTGCTACAAGGCCATCCTGGAGTTCGCAGAGAAGGAGGGCATG
GTATCCTCTGGCCAAAACCTGCTGGCCGTGGAGAGTCAGTAA
Protein Properties
Number of Residues 593
Molecular Weight 68019.58
Theoretical pI 8.009
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Tyrosine-protein phosphatase non-receptor type 9
MEPATAPRPDMAPELTPEEEQATKQFLEEINKWTVQYNVSPLSWNVAVKFLMARKFDVLR
AIELFHSYRETRRKEGIVKLKPHEEPLRSEILSGKFTILNVRDPTGASIALFTARLHHPH
KSVQHVVLQALFYLLDRAVDSFETQRNGLVFIYDMCGSNYANFELDLGKKVLNLLKGAFP
ARLKKVLIVGAPIWFRVPYSIISLLLKDKVRERIQILKTSEVTQHLPRECLPENLGGYVK
IDLATWNFQFLPQVNGHPDPFDEIILFSLPPALDWDSVHVPGPHAMTIQELVDYVNARQK
QGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQTDYINA
SFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLEK
DSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASL
IDFLRVVRNQQSLAVSNMGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGT
LNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEKEGMVSSGQNLLAVESQ
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P43378
UniProtKB/Swiss-Prot Entry Name PTN9_HUMAN
PDB IDs
GenBank Gene ID M83738
GeneCard ID PTPN9
GenAtlas ID PTPN9
HGNC ID HGNC:9661
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  3. Barr AJ, Ugochukwu E, Lee WH, King ON, Filippakopoulos P, Alfano I, Savitsky P, Burgess-Brown NA, Muller S, Knapp S: Large-scale structural analysis of the classical human protein tyrosine phosphatome. Cell. 2009 Jan 23;136(2):352-63. doi: 10.1016/j.cell.2008.11.038. [PubMed:19167335 ]
  4. Gu M, Warshawsky I, Majerus PW: Cloning and expression of a cytosolic megakaryocyte protein-tyrosine-phosphatase with sequence homology to retinaldehyde-binding protein and yeast SEC14p. Proc Natl Acad Sci U S A. 1992 Apr 1;89(7):2980-4. [PubMed:1557404 ]