You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08939
Secondary Accession Numbers
  • 14668
Name Receptor-type tyrosine-protein phosphatase N2
Synonyms
  1. IAR
  2. ICAAR
  3. Islet cell autoantigen-related protein
  4. Phogrin
  5. R-PTP-N2
Gene Name PTPRN2
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function Implicated in development of nervous system and pancreatic endocrine cells.
Pathways
  • Type I diabetes mellitus
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
GO Classification
Biological Process
negative regulation of GTPase activity
peptidyl-tyrosine dephosphorylation
Cellular Component
terminal button
secretory granule
transport vesicle membrane
integral to plasma membrane
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
Molecular Function
transmembrane receptor protein tyrosine phosphatase activity
protein tyrosine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein (Probable)
Gene Properties
Chromosome Location 7
Locus 7q36
SNPs PTPRN2
Gene Sequence
>3048 bp
ATGGGGCCGCCGCTCCCGCTGCTGCTGCTGCTACTGCTGCTGCTGCCGCCACGCGTCCTG
CCTGCCGCCCCTTCGTCCGTCCCCCGCGGCCGGCAGCTCCCGGGGCGTCTGGGCTGCCTG
CTCGAGGAGGGCCTCTGCGGAGCGTCCGAGGCCTGTGTGAACGATGGAGTGTTTGGAAGG
TGCCAGAAGGTTCCGGCAATGGACTTTTACCGCTACGAGGTGTCGCCCGTGGCCCTGCAG
CGCCTGCGCGTGGCGTTGCAGAAGCTTTCCGGCACAGGTTTCACGTGGCAGGATGACTAT
ACTCAGTATGTGATGGACCAGGAACTTGCAGACCTCCCGAAAACCTACCTGAGGCGTCCT
GAAGCATCCAGCCCAGCCAGGCCCTCAAAACACAGCGTTGGCAGCGAGAGGAGGTACAGT
CGGGAGGGCGGTGCTGCCCTGGCCAACGCCCTCCGACGCCACCTGCCCTTCCTGGAGGCC
CTGTCCCAGGCCCCAGCCTCAGACGTGCTCGCCAGGACCCATACGGCGCAGGACAGACCC
CCCGCTGAGGGTGATGACCGCTTCTCCGAGAGCATCCTGACCTATGTGGCCCACACGTCT
GCGCTGACCTACCCTCCCGGGTCCCGGACCCAGCTCCGCGAGGACCTCCTGCCGCGGACC
CTCGGCCAGCTCCAGCCAGATGAGCTCAGCCCTAAGGTGGACAGTGGTGTGGACAGACAC
CATCTGATGGCGGCCCTCAGTGCCTATGCTGCCCAGAGGCCCCCAGCTCCCCCCGGGGAG
GGCAGCCTGGAGCCACAGTACCTTCTGCGTGCACCCTCAAGAATGCCCAGGCCTTTGCTG
GCACCAGCCGCCCCCCAGAAGTGGCCTTCACCTCTGGGAGATTCCGAAGACCCCTCCAGC
ACAGGCGATGGAGCACGGATTCATACCCTCCTGAAGGACCTGCAGAGGCAGCCGGCTGAG
GTGAGGGGCCTGAGTGGCCTGGAGCTGGACGGCATGGCTGAGCTGATGGCTGGCCTGATG
CAAGGCGTGGACCATGGAGTAGCTCGAGGCAGCCCTGGGAGAGCGGCCCTGGGAGAGTCT
GGAGAACAGGCGGATGGCCCCAAGGCCACCCTCCGTGGAGACAGCTTTCCAGATGACGGA
GTGCAGGACGACGATGATAGACTTTACCAAGAGGTCCATCGTCTGAGTGCCACACTCGGG
GGCCTCCTGCAGGACCACGGGTCTCGACTCTTACCTGGAGCCCTCCCCTTTGCAAGGCCC
CTCGACATGGAGAGGAAGAAGTCCGAGCACCCTGAGTCTTCCCTGTCTTCAGAAGAGGAG
ACTGCCGGAGTGGAGAACGTCAAGAGCCAGACGTATTCCAAAGATCTGCTGGGGCAGCAG
CCGCATTCGGAGCCCGGGGCCGCTGCGTTTGGGGAGCTCCAAAACCAGATGCCTGGGCCC
TCGAAGGAGGAGCAGAGCCTTCCAGCGGGTGCTCAGGAGGCCCTCAGCGACGGCCTGCAA
TTGGAGGTCCAGCCTTCCGAGGAAGAGGCGCGGGGCTACATCGTGACAGACAGAGACCCC
CTGCGCCCCGAGGAAGGAAGGCGGCTGGTGGAGGACGTCGCCCGCCTCCTGCAGGTGCCC
AGCAGTGCGTTCGCTGACGTGGAGGTTCTCGGACCAGCAGTGACCTTCAAAGTGAGCGCC
AATGTCCAAAACGTGACCACTGAGGATGTGGAGAAGGCCACAGTTGACAACAAAGACAAA
CTGGAGGAAACCTCTGGACTGAAAATTCTTCAAACCGGAGTCGGGTCGAAAAGCAAACTC
AAGTTCCTGCCTCCTCAGGCGGAGCAAGAAGACTCCACCAAGTTCATCGCGCTCACCCTG
GTCTCCCTCGCCTGCATCCTGGGCGTCCTCCTGGCCTCTGGCCTCATCTACTGCCTCCGC
CATAGCTCTCAGCACAGGCTGAAGGAGAAGCTCTCGGGACTAGGGGGCGACCCAGGTGCA
GATGCCACTGCCGCCTACCAGGAGCTGTGCCGCCAGCGTATGGCCACGCGGCCACCAGAC
CGACCTGAGGGCCCGCACACGTCACGCATCAGCAGCGTCTCATCCCAGTTCAGCGACGGG
CCGATCCCCAGCCCCTCCGCACGCAGCAGCGCCTCATCCTGGTCCGAGGAGCCTGTGCAG
TCCAACATGGACATCTCCACCGGCCACATGATCCTGTCCTACATGGAGGACCACCTGAAG
AACAAGAACCGGCTGGAGAAGGAGTGGGAAGCGCTGTGCGCCTACCAGGCGGAGCCCAAC
AGCTCGTTCGTGGCCCAGAGGGAGGAGAACGTGCCCAAGAACCGCTCCCTGGCCGTGCTG
ACCTATGACCACTCCCGGGTCCTGCTGAAGGCGGAGAACAGCCACAGCCACTCAGACTAC
ATCAACGCTAGCCCCATCATGGATCACGACCCGAGGAACCCCGCGTACATCGCCACCCAG
GGACCGCTGCCCGCCACCGTGGCTGACTTTTGGCAGATGGTGTGGGAGAGCGGCTGCGTG
GTGATCGTCATGCTGACACCCCTCGCGGAGAACGGCGTCCGGCAGTGCTACCACTACTGG
CCGGATGAAGGCTCCAATCTCTACCACATCTATGAGGTGAACCTGGTCTCCGAGCACATC
TGGTGTGAGGACTTCCTGGTGAGGAGCTTCTATCTGAAGAACCTGCAGACCAACGAGACG
CGCACCGTGACGCAGTTCCACTTCCTGAGTTGGTATGACCGAGGAGTCCCTTCCTCCTCA
AGGTCCCTCCTGGACTTCCGCAGAAAAGTAAACAAGTGCTACAGGGGCCGTTCTTGTCCA
ATAATTGTTCATTGCAGTGACGGTGCAGGCCGGAGCGGCACCTACGTCCTGATCGACATG
GTTCTCAACAAGATGGCCAAAGGTGCTAAAGAGATTGATATCGCAGCGACCCTGGAGCAC
TTGAGGGACCAGAGACCCGGCATGGTCCAGACGAAGGAGCAGTTTGAGTTCGCGCTGACA
GCCGTGGCTGAGGAGGTGAACGCCATCCTCAAGGCCCTTCCCCAGTGA
Protein Properties
Number of Residues 1015
Molecular Weight 111270.29
Theoretical pI 5.828
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Receptor-type tyrosine-protein phosphatase N2
MGPPLPLLLLLLLLLPPRVLPAAPSSVPRGRQLPGRLGCLLEEGLCGASEACVNDGVFGR
CQKVPAMDFYRYEVSPVALQRLRVALQKLSGTGFTWQDDYTQYVMDQELADLPKTYLRRP
EASSPARPSKHSVGSERRYSREGGAALANALRRHLPFLEALSQAPASDVLARTHTAQDRP
PAEGDDRFSESILTYVAHTSALTYPPGSRTQLREDLLPRTLGQLQPDELSPKVDSGVDRH
HLMAALSAYAAQRPPAPPGEGSLEPQYLLRAPSRMPRPLLAPAAPQKWPSPLGDSEDPSS
TGDGARIHTLLKDLQRQPAEVRGLSGLELDGMAELMAGLMQGVDHGVARGSPGRAALGES
GEQADGPKATLRGDSFPDDGVQDDDDRLYQEVHRLSATLGGLLQDHGSRLLPGALPFARP
LDMERKKSEHPESSLSSEEETAGVENVKSQTYSKDLLGQQPHSEPGAAAFGELQNQMPGP
SKEEQSLPAGAQEALSDGLQLEVQPSEEEARGYIVTDRDPLRPEEGRRLVEDVARLLQVP
SSAFADVEVLGPAVTFKVSANVQNVTTEDVEKATVDNKDKLEETSGLKILQTGVGSKSKL
KFLPPQAEQEDSTKFIALTLVSLACILGVLLASGLIYCLRHSSQHRLKEKLSGLGGDPGA
DATAAYQELCRQRMATRPPDRPEGPHTSRISSVSSQFSDGPIPSPSARSSASSWSEEPVQ
SNMDISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNSSFVAQREENVPKNRSLAVL
TYDHSRVLLKAENSHSHSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWESGCV
VIVMLTPLAENGVRQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNET
RTVTQFHFLSWYDRGVPSSSRSLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYVLIDM
VLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILKALPQ
GenBank ID Protein 194097440
UniProtKB/Swiss-Prot ID Q92932
UniProtKB/Swiss-Prot Entry Name PTPR2_HUMAN
PDB IDs
GenBank Gene ID NM_002847.3
GeneCard ID PTPRN2
GenAtlas ID PTPRN2
HGNC ID HGNC:9677
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  4. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  5. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  6. Nagase T, Ishikawa K, Nakajima D, Ohira M, Seki N, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1997 Apr 28;4(2):141-50. [PubMed:9205841 ]
  7. Barr AJ, Ugochukwu E, Lee WH, King ON, Filippakopoulos P, Alfano I, Savitsky P, Burgess-Brown NA, Muller S, Knapp S: Large-scale structural analysis of the classical human protein tyrosine phosphatome. Cell. 2009 Jan 23;136(2):352-63. doi: 10.1016/j.cell.2008.11.038. [PubMed:19167335 ]
  8. Kawasaki E, Hutton JC, Eisenbarth GS: Molecular cloning and characterization of the human transmembrane protein tyrosine phosphatase homologue, phogrin, an autoantigen of type 1 diabetes. Biochem Biophys Res Commun. 1996 Oct 14;227(2):440-7. [PubMed:8878534 ]
  9. Smith PD, Barker KT, Wang J, Lu YJ, Shipley J, Crompton MR: ICAAR, a novel member of a new family of transmembrane, tyrosine phosphatase-like proteins. Biochem Biophys Res Commun. 1996 Dec 13;229(2):402-11. [PubMed:8954911 ]
  10. Cui L, Yu WP, DeAizpurua HJ, Schmidli RS, Pallen CJ: Cloning and characterization of islet cell antigen-related protein-tyrosine phosphatase (PTP), a novel receptor-like PTP and autoantigen in insulin-dependent diabetes. J Biol Chem. 1996 Oct 4;271(40):24817-23. [PubMed:8798755 ]