Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08941
Secondary Accession Numbers
  • 14670
Name Receptor-type tyrosine-protein phosphatase delta
Synonyms
  1. Protein-tyrosine phosphatase delta
  2. R-PTP-delta
Gene Name PTPRD
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function Not Available
Pathways Not Available
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
GO Classification
Biological Process
presynaptic membrane assembly
heterophilic cell-cell adhesion
positive regulation of dendrite morphogenesis
transmembrane receptor protein tyrosine phosphatase signaling pathway
neuron differentiation
Cellular Component
integral to plasma membrane
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
Molecular Function
receptor binding
transmembrane receptor protein tyrosine phosphatase activity
cell adhesion molecule binding
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location 9
Locus 9p23-p24.3
SNPs PTPRD
Gene Sequence
>5739 bp
ATGGTGCACGTAGCCAGGCTGCTGCTGCTGCTCCTCACTTTCTTCCTCCGCACGGATGCT
GAGACACCTCCAAGGTTTACACGAACACCCGTTGATCAGACAGGGGTCTCTGGCGGAGTT
GCCTCTTTCATCTGCCAAGCTACGGGAGACCCAAGACCTAAAATTGTCTGGAACAAAAAA
GGAAAGAAAGTCAGCAATCAGAGATTTGAGGTAATAGAGTTTGACGATGGGTCTGGATCA
GTTCTCAGAATACAACCCTTACGGACTCCGAGGGATGAGGCCATTTATGAATGTGTGGCC
TCAAATAATGTGGGAGAAATAAGTGTATCCACCAGACTCACAGTTTTGCGGGAAGATCAA
ATTCCCAGGGGCTTCCCTACCATTGACATGGGCCCACAGTTGAAGGTGGTTGAGCGTACT
CGCACGGCCACCATGCTTTGTGCAGCCAGTGGTAATCCGGATCCAGAAATCACTTGGTTT
AAAGATTTCTTACCTGTGGACACAAGCAACAACAATGGTCGTATTAAGCAGTTACGATCA
GAATCTATTGGTGGTACACCAATAAGAGGAGCCCTTCAGATTGAGCAGAGTGAAGAGTCT
GACCAAGGAAAATATGAGTGTGTTGCCACCAACAGCGCGGGCACTCGCTATTCCGCTCCT
GCCAATTTATATGTCAGAGAGCTGCGAGAAGTTCGCCGTGTCCCACCAAGATTCTCTATC
CCACCCACTAATCATGAAATCATGCCAGGCGGAAGCGTTAATATCACCTGTGTGGCCGTG
GGGTCACCAATGCCTTATGTAAAGTGGATGTTGGGGGCAGAAGATCTGACACCTGAAGAT
GATATGCCAATAGGAAGAAATGTGCTAGAACTGAATGATGTAAGACAGTCAGCAAATTAC
ACCTGTGTTGCTATGTCAACACTGGGTGTCATTGAAGCAATAGCACAGATCACTGTCAAA
GCCTTACCCAAACCTCCAGGAACTCCTGTAGTGACCGAGAGCACAGCTACAAGCATCACA
CTGACGTGGGACTCTGGGAACCCTGAGCCTGTTTCTTATTACATAATTCAGCATAAACCT
AAAAACTCTGAGGAACTTTACAAAGAAATTGATGGGGTGGCGACCACACGCTACAGTGTC
GCTGGACTAAGTCCCTACTCGGATTATGAATTCAGGGTTGTTGCTGTCAATAACATTGGG
CGGGGGCCTCCCAGCGAACCTGTGCTAACACAAACCTCAGAGCAAGCACCATCCAGTGCC
CCGAGGGATGTCCAGGCACGAATGTTGAGTTCGACCACCATTTTGGTACAGTGGAAGGAA
CCTGAAGAGCCAAATGGACAGATCCAAGGATATAGAGTTTATTATACAATGGATCCCACT
CAACATGTCAACAACTGGATGAAACACAATGTAGCTGACAGCCAAATCACTACTATTGGC
AACTTAGTGCCCCAGAAAACATATTCTGTCAAAGTCCTGGCTTTTACCTCAATTGGAGAT
GGTCCCCTTTCAAGTGACATACAAGTCATCACTCAGACAGGAGTACCAGGGCAGCCACTA
AACTTCAAAGCAGAACCTGAGTCTGAAACAAGTATTTTGCTCTCTTGGACACCTCCACGT
TCAGATACCATTGCCAACTATGAACTGGTCTACAAAGATGGGGAGCATGGAGAGGAGCAA
CGAATTACCATTGAGCCAGGGACATCATATAGGCTGCAAGGACTGAAACCAAACAGCTTA
TACTATTTCCGTCTGGCTGCACGCTCCCCTCAAGGCCTGGGTGCTTCTACTGCAGAAATA
TCAGCTAGAACCATGCAGTCAAAGCCGTCAGCTCCTCCTCAAGACATTAGTTGCACCAGC
CCAAGTTCCACTAGTATTTTGGTAAGTTGGCAACCTCCACCAGTGGAAAAACAGAATGGC
ATTATCACTGAATACTCCATCAAGTACACTGCAGTGGATGGGGAAGATGACAAGCCTCAC
GAGATTTTGGGAATTCCTTCGGACACTACCAAATACCTTTTGGAACAGCTGGAAAAATGG
ACTGAATACCGGATCACTGTGACAGCCCATACAGATGTCGGCCCTGGCCCTGAGAGCTTG
TCCGTGTTGATTCGAACCAATGAAGATGTTCCTAGTGGTCCTCCTCGCAAAGTCGAGGTA
GAGGCTGTCAACTCAACATCTGTTAAAGTCTCATGGCGCTCACCCGTGCCCAATAAACAG
CATGGCCAGATAAGAGGATATCAGGTGCATTATGTGAGGATGGAAAATGGTGAGCCCAAG
GGCCAGCCCATGCTGAAAGATGTCATGCTGGCTGATGCACAGTGGGAATTTGATGATACT
ACTGAACATGACATGATCATTTCTGGGCTCCAGCCTGAAACTTCCTACTCCCTCACCGTC
ACAGCCTACACAACCAAAGGAGATGGTGCTCGCAGCAAGCCCAAACTGGTGTCCACCACT
GGGGCAGTTCCAGGGAAACCTCGGCTTGTGATTAACCACACTCAGATGAATACTGCTCTT
ATTCAGTGGCACCCTCCGGTGGACACATTTGGACCTCTTCAGGGCTACCGTCTAAAATTT
GGCCGCAAGGATATGGAGCCACTTACTACTCTTGAGTTCTCTGAAAAAGAAGATCACTTT
ACAGCTACAGACATCCACAAGGGAGCATCATACGTCTTCAGGCTCTCAGCCAGAAACAAA
GTGGGCTTTGGGGAGGAGATGGTGAAGGAGATTTCCATTCCAGAAGAAGTACCAACTGGA
TTCCCTCAAAACCTTCACTCAGAAGGCACCACTTCAACCTCCGTCCAGTTATCTTGGCAA
CCACCTGTCCTGGCAGAGAGAAATGGCATTATCACCAAGTATACCCTTCTTTATAGGGAT
ATCAACATCCCCCTTCTCCCGATGGAGCAGCTTATTGTTCCAGCTGACACCACTATGACA
CTCACTGGCTTAAAACCAGATACCACATACGATGTAAAAGTACGTGCTCATACGAGCAAA
GGGCCCGGGCCATATAGTCCCAGTGTCCAGTTCAGGACACTGCCTGTGGATCAAGTGTTT
GCAAAAAATTTTCATGTCAAAGCAGTAATGAAGACTTCCGTGTTGCTGTCTTGGGAGATT
CCAGAGAATTATAACTCCGCCATGCCTTTCAAAATTCTTTATGATGATGGGAAAATGGTA
GAAGAAGTGGATGGCCGAGCCACACAGAAGTTAATTGTCAACCTGAAGCCTGAGAAATCA
TATTCATTTGTGCTGACAAATCGTGGAAACAGTGCTGGTGGGCTGCAGCACAGGGTCACG
GCAAAGACTGCACCAGATGTATTACGTACCAAGCCTGCCTTCATTGGGAAGACCAACTTG
GATGGCATGATTACTGTGCAACTGCCTGAAGTACCTGCAAATGAGAATATAAAAGGTTAC
TACATAATAATTGTGCCTTTGAAGAAATCTCGCGGGAAATTTATCAAGCCATGGGAGAGT
CCAGATGAAATGGAATTAGATGAGCTGCTTAAGGAGATATCTAGGAAGCGCAGAAGCATC
CGTTATGGGAGAGAAGTTGAATTAAAGCCATATATTGCCGCTCACTTTGATGTCCTTCCC
ACTGAGTTCACCCTGGGGGATGACAAGCATTATGGTGGATTTACAAACAAGCAACTCCAA
AGTGGTCAAGAATATGTCTTCTTTGTGTTAGCAGTAATGGAACATGCAGAGTCTAAGATG
TATGCAACCAGCCCTTACTCCGACCCCGTGGTGTCAATGGATCTGGATCCGCAGCCAATC
ACGGATGAAGAAGAAGGCTTGATCTGGGTTGTAGGTCCTGTCCTTGCAGTGGTCTTTATC
ATCTGCATTGTCATTGCTATTCTTCTTTATAAAAGGAAGAGGGCAGAGTCCGACTCTAGA
AAAAGCAGCATACCGAACAATAAGGAGATCCCTTCACACCACCCAACAGACCCTGTAGAA
CTGAGGCGCCTTAACTTTCAAACACCGGGTATGGCTAGCCATCCTCCAATACCCATCTTG
GAACTTGCAGACCACATTGAAAGATTGAAAGCAAATGACAACTTGAAGTTTTCCCAGGAA
TATGAGTCAATTGACCCTGGCCAGCAGTTCACTTGGGAACATTCAAACTTGGAAGTAAAC
AAACCAAAGAATAGATACGCGAATGTAATCGCATATGATCATTCCCGGGTTCTCCTATCA
GCTATAGAAGGGATCCCAGGAAGTGACTATGTGAATGCCAACTACATAGATGGGTATAGG
AAGCAAAATGCCTATATTGCAACACAGGGATCTCTCCCCGAAACATTTGGGGACTTTTGG
AGAATGATATGGGAACAACGGAGTGCCACAGTTGTCATGATGACAAAACTAGAAGAAAGA
TCAAGGGTGAAGTGTGACCAGTATTGGCCTAGCAGAGGCACAGAAACCCACGGACTCGTT
CAAGTAACGCTGCTTGATACTGTGGAGCTGGCCACATATTGTGTTCGAACATTTGCACTT
TACAAGAATGGTTCAAGTGAGAAGAGAGAAGTGAGACAATTCCAGTTCACCGCCTGGCCT
GATCATGGTGTTCCAGAACACCCTACACCTTTTCTAGCTTTCTTACGTAGAGTCAAAACC
TGTAACCCTCCCGATGCTGGTCCGATGGTTGTGCACTGCAGTGCGGGAGTTGGCCGGACT
GGTTGCTTCATCGTCATAGATGCCATGTTAGAAAGAATAAAGCATGAAAAAACTGTAGAT
ATTTATGGCCATGTAACTTTAATGAGAGCCCAGAGGAACTATATGGTTCAAACAGAAGAC
CAATACATCTTTATCCATGATGCACTGTTAGAAGCAGTGACTTGTGGAAATACCGAAGTG
CCAGCTAGAAACTTGTATGCCTACATTCAGAAGCTGACACAAATAGAAACGGGAGAGAAT
GTCACAGGAATGGAGCTCGAATTTAAGCGTCTAGCCAGCTCAAAAGCTCACACCTCAAGG
TTTATCAGTGCCAATCTTCCATGTAATAAATTCAAAAATCGCCTTGTTAATATTATGCCA
TATGAATCCACAAGGGTATGCCTGCAGCCTATCCGTGGAGTAGAAGGATCTGATTACATC
AATGCCAGTTTTATTGATGGATACAGACAACAGAAAGCCTACATCGCTACCCAGGGGCCC
TTGGCAGAGACCACTGAAGACTTCTGGCGGATGCTCTGGGAACACAATTCCACCATAGTT
GTGATGCTCACCAAGCTGCGTGAAATGGGCAGAGAGAAATGTCACCAATACTGGCCAGCA
GAACGGTCTGCAAGATACCAGTACTTTGTTGTAGATCCCATGGCTGAGTACAACATGCCA
CAGTATATCCTAAGGGAATTCAAGGTCACAGATGCCAGGGACGGCCAGTCCCGAACAGTA
AGGCAGTTCCAGTTCACTGACTGGCCAGAGCAAGGAGTGCCAAAGTCCGGAGAAGGATTT
ATTGACTTCATCGGCCAAGTCCATAAAACAAAAGAACAGTTTGGCCAAGATGGACCCATT
TCAGTCCATTGCAGCGCGGGCGTTGGAAGAACTGGAGTCTTCATAACGCTAAGCATTGTT
TTGGAAAGAATGAGATATGAAGGAGTTGTAGATATCTTCCAGACTGTCAAAATGTTAAGA
ACACAACGACCAGCTATGGTACAGACAGAGGATCAATATCAGTTTTCCTATCGTGCCGCA
CTAGAGTACCTGGGCAGCTTTGACCACTATGCAACGTAG
Protein Properties
Number of Residues 1912
Molecular Weight 169472.32
Theoretical pI 6.674
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Receptor-type tyrosine-protein phosphatase delta
MVHVARLLLLLLTFFLRTDAETPPRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKK
GKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLREDQ
IPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRS
ESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRELREVRRVPPRFSI
PPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGRNVLELNDVRQSANY
TCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWDSGNPEPVSYYIIQHKP
KNSEELYKEIDGVATTRYSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSA
PRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVADSQITTIG
NLVPQKTYSVKVLAFTSIGDGPLSSDIQVITQTGVPGQPLNFKAEPESETSILLSWTPPR
SDTIANYELVYKDGEHGEEQRITIEPGTSYRLQGLKPNSLYYFRLAARSPQGLGASTAEI
SARTMQSKPSAPPQDISCTSPSSTSILVSWQPPPVEKQNGIITEYSIKYTAVDGEDDKPH
EILGIPSDTTKYLLEQLEKWTEYRITVTAHTDVGPGPESLSVLIRTNEDVPSGPPRKVEV
EAVNSTSVKVSWRSPVPNKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQWEFDDT
TEHDMIISGLQPETSYSLTVTAYTTKGDGARSKPKLVSTTGAVPGKPRLVINHTQMNTAL
IQWHPPVDTFGPLQGYRLKFGRKDMEPLTTLEFSEKEDHFTATDIHKGASYVFRLSARNK
VGFGEEMVKEISIPEEVPTGFPQNLHSEGTTSTSVQLSWQPPVLAERNGIITKYTLLYRD
INIPLLPMEQLIVPADTTMTLTGLKPDTTYDVKVRAHTSKGPGPYSPSVQFRTLPVDQVF
AKNFHVKAVMKTSVLLSWEIPENYNSAMPFKILYDDGKMVEEVDGRATQKLIVNLKPEKS
YSFVLTNRGNSAGGLQHRVTAKTAPDVLRTKPAFIGKTNLDGMITVQLPEVPANENIKGY
YIIIVPLKKSRGKFIKPWESPDEMELDELLKEISRKRRSIRYGREVELKPYIAAHFDVLP
TEFTLGDDKHYGGFTNKQLQSGQEYVFFVLAVMEHAESKMYATSPYSDPVVSMDLDPQPI
TDEEEGLIWVVGPVLAVVFIICIVIAILLYKRKRAESDSRKSSIPNNKEIPSHHPTDPVE
LRRLNFQTPGMASHPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVN
KPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFW
RMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFAL
YKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRT
GCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEV
PARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMP
YESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIV
VMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTV
RQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIV
LERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYLGSFDHYAT
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P23468
UniProtKB/Swiss-Prot Entry Name PTPRD_HUMAN
PDB IDs
GenBank Gene ID L38929
GeneCard ID PTPRD
GenAtlas ID PTPRD
HGNC ID HGNC:9668
References
General References
  1. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  2. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  3. Hillman RT, Green RE, Brenner SE: An unappreciated role for RNA surveillance. Genome Biol. 2004;5(2):R8. Epub 2004 Feb 2. [PubMed:14759258 ]
  4. Krueger NX, Streuli M, Saito H: Structural diversity and evolution of human receptor-like protein tyrosine phosphatases. EMBO J. 1990 Oct;9(10):3241-52. [PubMed:2170109 ]
  5. Serra-Pages C, Medley QG, Tang M, Hart A, Streuli M: Liprins, a family of LAR transmembrane protein-tyrosine phosphatase-interacting proteins. J Biol Chem. 1998 Jun 19;273(25):15611-20. [PubMed:9624153 ]
  6. Pulido R, Krueger NX, Serra-Pages C, Saito H, Streuli M: Molecular characterization of the human transmembrane protein-tyrosine phosphatase delta. Evidence for tissue-specific expression of alternative human transmembrane protein-tyrosine phosphatase delta isoforms. J Biol Chem. 1995 Mar 24;270(12):6722-8. [PubMed:7896816 ]