Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08943
Secondary Accession Numbers
  • 14672
Name Receptor-type tyrosine-protein phosphatase F
Synonyms
  1. LAR
  2. Leukocyte common antigen related
Gene Name PTPRF
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function Possible cell adhesion receptor. It possesses an intrinsic protein tyrosine phosphatase activity (PTPase). The first PTPase domain has enzymatic activity, while the second one seems to affect the substrate specificity of the first one.
Pathways
  • Adherens junction
  • Cell adhesion molecules
  • Insulin signaling pathway
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
GO Classification
Biological Process
negative regulation of insulin receptor signaling pathway
cell adhesion
regulation of synapse structure and activity
negative regulation of cytokine-mediated signaling pathway
positive regulation of dendrite morphogenesis
transmembrane receptor protein tyrosine phosphatase signaling pathway
homophilic cell adhesion
negative regulation of cell projection organization
negative regulation of epidermal growth factor receptor signaling pathway
negative regulation of nerve growth factor receptor signaling pathway
negative regulation of cell proliferation
positive regulation of neuron apoptotic process
Cellular Component
growth cone
excitatory synapse
neuronal cell body
integral to plasma membrane
endosome
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
Molecular Function
transmembrane receptor protein tyrosine phosphatase activity
heparin binding
phosphate ion binding
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location 1
Locus 1p34
SNPs PTPRF
Gene Sequence
>5724 bp
ATGGCCCCTGAGCCAGCCCCAGGGAGGACGATGGTGCCCCTTGTGCCTGCACTGGTGATG
CTTGGTTTGGTGGCAGGCGCCCATGGTGACAGCAAACCTGTCTTCATTAAAGTCCCTGAG
GACCAGACTGGGCTGTCAGGAGGGGTAGCCTCCTTCGTGTGCCAAGCTACAGGAGAACCC
AAGCCGCGCATCACATGGATGAAGAAGGGGAAGAAAGTCAGCTCCCAGCGCTTCGAGGTC
ATTGAGTTTGATGATGGGGCAGGGTCAGTGCTTCGGATCCAGCCATTGCGGGTGCAGCGA
GATGAAGCCATCTATGAGTGTACAGCTACTAACAGCCTGGGTGAGATCAACACTAGTGCC
AAGCTCTCAGTGCTCGAAGAGGAACAGCTGCCCCCTGGGTTCCCTTCCATCGACATGGGG
CCTCAGCTGAAGGTGGTGGAGAAGGCACGCACAGCCACCATGCTATGTGCCGCAGGCGGA
AATCCAGACCCTGAGATTTCTTGGTTCAAGGACTTCCTTCCTGTAGACCCTGCCACGAGC
AACGGCCGCATCAAGCAGCTGCGTTCAGGTGCCTTGCAGATAGAGAGCAGTGAGGAATCC
GACCAAGGCAAGTACGAGTGTGTGGCGACCAACTCGGCAGGCACACGTTACTCAGCCCCT
GCGAACCTGTATGTGCGAGTGCGCCGCGTGGCTCCTCGTTTCTCCATCCCTCCCAGCAGC
CAGGAGGTGATGCCAGGCGGCAGCGTGAACCTGACATGCGTGGCAGTGGGTGCACCCATG
CCCTACGTGAAGTGGATGATGGGGGCCGAGGAGCTCACCAAGGAGGATGAGATGCCAGTT
GGCCGCAACGTCCTGGAGCTCAGCAATGTCGTACGCTCTGCCAACTACACCTGTGTGGCC
ATCTCCTCGCTGGGCATGATCGAGGCCACAGCCCAGGTCACAGTGAAAGCTCTTCCAAAG
CCTCCGATTGATCTTGTGGTGACAGAGACAACTGCCACCAGTGTCACCCTCACCTGGGAC
TCTGGGAACTCGGAGCCTGTAACCTACTATGGCATCCAGTACCGCGCAGCGGGCACGGAG
GGCCCCTTTCAGGAGGTGGATGGTGTGGCCACCACCCGCTACAGCATTGGCGGCCTCAGC
CCTTTCTCGGAATATGCCTTCCGCGTGCTGGCGGTGAACAGCATCGGGCGAGGGCCGCCC
AGCGAGGCAGTGCGGGCACGCACGGGAGAACAGGCGCCCTCCAGCCCACCGCGCCGCGTG
CAGGCACGCATGCTGAGCGCCAGCACCATGCTGGTGCAGTGGGAGCCTCCCGAGGAGCCC
AACGGCCTGGTGCGGGGATACCGCGTCTACTATACTCCGGACTCCCGCCGCCCCCCGAAC
GCCTGGCACAAGCACAACACCGACGCGGGGCTCCTCACGACCGTGGGCAGCCTGCTGCCT
GGCATCACCTACAGCCTGCGCGTGCTTGCCTTCACCGCCGTGGGCGATGGCCCTCCCAGC
CCCACCATCCAGGTCAAGACGCAGCAGGGAGTGCCTGCCCAGCCCGCGGACTTCCAGGCC
GAGGTGGAGTCGGACACCAGGATCCAGCTCTCGTGGCTGCTGCCCCCTCAGGAGCGGATC
ATCATGTATGAACTGGTGTACTGGGCGGCAGAGGACGAAGACCAACAGCACAAGGTGACC
TTCGACCCAACCTCCTCCTACACACTAGAGGACCTGAAGCCTGACACACTCTACCGCTTC
CAGCTGGCTGCACGCTCGGATATGGGGGTGGGCGTCTTCACCCCCACCATTGAGGCCCGC
ACAGCCCAGTCCACCCCCTCCGCCCCTCCCCAGAAGGTGATGTGTGTGAGCATGGGCTCC
ACCACGGTCCGGGTAAGTTGGGTCCCGCCGCCTGCCGACAGCCGCAACGGCGTTATCACC
CAGTACTCCGTGGCCTACGAGGCGGTGGACGGCGAGGACCGCGGGCGGCATGTGGTGGAT
GGCATCAGCCGTGAGCACTCCAGCTGGGACCTGGTGGGCCTGGAGAAGTGGACGGAGTAC
CGGGTGTGGGTGCGGGCACACACAGACGTGGGCCCCGGCCCCGAGAGCAGCCCGGTGCTG
GTGCGCACCGATGAGGACGTGCCCAGCGGGCCTCCGCGGAAGGTGGAGGTGGAGCCACTG
AACTCCACTGCTGTGCATGTCTACTGGAAGCTGCCTGTCCCCAGCAAGCAGCATGGCCAG
ATCCGCGGCTACCAGGTCACCTACGTGCGGCTGGAGAATGGCGAGCCCCGTGGACTCCCC
ATCATCCAAGACGTCATGCTAGCCGAGGCCCAGTGGCGGCCAGAGGAGTCCGAGGACTAT
GAAACCACTATCAGCGGCCTGACCCCGGAGACCACCTACTCCGTTACTGTTGCTGCCTAT
ACCACCAAGGGGGATGGTGCCCGCAGCAAGCCCAAAATTGTCACTACAACAGGTGCAGTC
CCAGGCCGGCCCACCATGATGATCAGCACCACGGCCATGAACACTGCGCTGCTCCAGTGG
CACCCACCCAAGGAACTGCCTGGCGAGCTGCTGGGCTACCGGCTGCAGTACTGCCGGGCC
GACGAGGCGCGGCCCAACACCATAGATTTCGGCAAGGATGACCAGCACTTCACAGTCACC
GGCCTGCACAAGGGGACCACCTACATCTTCCGGCTTGCTGCCAAGAACCGGGCTGGCTTG
GGTGAGGAGTTCGAGAAGGAGATCAGGACCCCCGAGGACCTGCCCAGCGGCTTCCCCCAA
AACCTGCATGTGACAGGACTGACCACGTCTACCACAGAACTGGCCTGGGACCCGCCAGTG
CTGGCGGAGAGGAACGGGCGCATCATCAGCTACACCGTGGTGTTCCGAGACATCAACAGC
CAACAGGAGCTGCAGAACATCACGACAGACACCCGCTTTACCCTTACTGGCCTCAAGCCA
GACACCACTTACGACATCAAGGTCCGCGCATGGACCAGCAAAGGCTCTGGCCCACTCAGC
CCCAGCATCCAGTCCCGGACCATGCCGGTGGAGCAAGTGTTTGCCAAGAACTTCCGGGTG
GCGGCTGCAATGAAGACGTCTGTGCTGCTCAGCTGGGAGGTTCCCGACTCCTATAAGTCA
GCTGTGCCCTTTAAGATTCTGTACAATGGGCAGAGTGTGGAGGTGGACGGGCACTCGATG
CGGAAGCTGATCGCAGACCTGCAGCCCAACACAGAGTACTCGTTTGTGCTGATGAACCGT
GGCAGCAGCGCAGGGGGCCTGCAGCACCTGGTGTCCATCCGCACAGCCCCCGACCTCCTG
CCTCACAAGCCGCTGCCTGCCTCTGCCTACATAGAGGACGGCCGCTTCGATCTCTCCATG
CCCCATGTGCAAGACCCCTCGCTTGTCAGGTGGTTCTACATTGTTGTGGTGCCCATTGAC
CGTGTGGGCGGGAGCATGCTGACGCCAAGGTGGAGCACACCCGAGGAACTGGAGCTGGAC
GAGCTTCTAGAAGCCATCGAGCAAGGCGGAGAGGAGCAGCGGCGGCGGCGGCGGCAGGCA
GAACGTCTGAAGCCATATGTGGCTGCTCAACTGGATGTGCTCCCGGAGACCTTTACCTTG
GGGGACAAGAAGAACTACCGGGGCTTCTACAACCGGCCCCTGTCTCCGGACTTGAGCTAC
CAGTGCTTTGTGCTTGCCTCCTTGAAGGAACCCATGGACCAGAAGCGCTATGCCTCCAGC
CCCTACTCGGATGAGATCGTGGTCCAGGTGACACCAGCCCAGCAGCAGGAGGAGCCGGAG
ATGCTGTGGGTGACGGGTCCCGTGCTGGCAGTCATCCTCATCATCCTCATTGTCATCGCC
ATCCTCTTGTTCAAAAGGAAAAGGACCCACTCTCCGTCCTCTAAGGATGAGCAGTCGATC
GGACTGAAGGACTCCTTGCTGGCCCACTCCTCTGACCCTGTGGAGATGCGGAGGCTCAAC
TACCAGACCCCAGGTATGCGAGACCACCCACCCATCCCCATCACCGACCTGGCGGACAAC
ATCGAGCGCCTCAAAGCCAACGATGGCCTCAAGTTCTCCCAGGAGTATGAGTCCATCGAC
CCTGGACAGCAGTTCACGTGGGAGAATTCAAACCTGGAGGTGAACAAGCCCAAGAACCGC
TATGCGAATGTCATCGCCTACGACCACTCTCGAGTCATCCTTACCTCTATCGATGGCGTC
CCCGGGAGTGACTACATCAATGCCAACTACATCGATGGCTACCGCAAGCAGAATGCCTAC
ATCGCCACGCAGGGCCCCCTGCCCGAGACCATGGGTGATTTCTGGAGGATGGTGTGGGAA
CAGCGCACGGCCACTGTGGTCATGATGACACGGCTGGAGGAGAAGTCCCGGGTAAAATGT
GATCAGTACTGGCCAGCCCGTGGCACCGAGACCTGTGGCCTTATTCAGGTGACCCTGTTG
GACACAGTGGAGCTGGCCACATACACTGTGCGCACCTTCGCACTCCACAAGAGTGGCTCC
AGTGAGAAGCGCGAGCTGCGTCAGTTTCAGTTCATGGCCTGGCCAGACCATGGAGTTCCT
GAGTACCCAACTCCCATCCTGGCCTTCCTACGACGGGTCAAGGCCTGCAACCCCCTAGAC
GCAGGGCCCATGGTGGTGCACTGCAGCGCGGGCGTGGGCCGCACCGGCTGCTTCATCGTG
ATTGATGCCATGTTGGAGCGGATGAAGCACGAGAAGACGGTGGACATCTATGGCCACGTG
ACCTGCATGCGATCACAGAGGAACTACATGGTGCAGACGGAGGACCAGTACGTGTTCATC
CATGAGGCGCTGCTGGAGGCTGCCACGTGCGGCCACACAGAGGTGCCTGCCCGCAACCTG
TATGCCCACATCCAGAAGCTGGGCCAAGTGCCTCCAGGGGAGAGTGTGACCGCCATGGAG
CTCGAGTTCAAGTTGCTGGCCAGCTCCAAGGCCCACACGTCCCGCTTCATCAGCGCCAAC
CTGCCCTGCAACAAGTTCAAGAACCGGCTGGTGAACATCATGCCCTACGAATTGACCCGT
GTGTGTCTGCAGCCCATCCGTGGTGTGGAGGGCTCTGACTACATCAATGCCAGCTTCCTG
GATGGTTATAGACAGCAGAAGGCCTACATAGCTACACAGGGGCCTCTGGCAGAGAGCACC
GAGGACTTCTGGCGCATGCTATGGGAGCACAATTCCACCATCATCGTCATGCTGACCAAG
CTTCGGGAGATGGGCAGGGAGAAATGCCACCAGTACTGGCCAGCAGAGCGCTCTGCTCGC
TACCAGTACTTTGTTGTTGACCCGATGGCTGAGTACAACATGCCCCAGTATATCCTGCGT
GAGTTCAAGGTCACGGATGCCCGGGATGGGCAGTCAAGGACAATCCGGCAGTTCCAGTTC
ACAGACTGGCCAGAGCAGGGCGTGCCCAAGACAGGCGAGGGATTCATTGACTTCATCGGG
CAGGTGCATAAGACCAAGGAGCAGTTTGGACAGGATGGGCCTATCACGGTGCACTGCAGT
GCTGGCGTGGGCCGCACCGGGGTGTTCATCACTCTGAGCATCGTCCTGGAGCGCATGCGC
TACGAGGGCGTGGTCGACATGTTTCAGACCGTGAAGACCCTGCGTACACAGCGTCCTGCC
ATGGTGCAGACAGAGGACCAGTATCAGCTGTGCTACCGTGCGGCCCTGGAGTACCTCGGC
AGCTTTGACCACTATGCAACGTAA
Protein Properties
Number of Residues 1907
Molecular Weight 212877.35
Theoretical pI 6.302
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Receptor-type tyrosine-protein phosphatase F
MAPEPAPGRTMVPLVPALVMLGLVAGAHGDSKPVFIKVPEDQTGLSGGVASFVCQATGEP
KPRITWMKKGKKVSSQRFEVIEFDDGAGSVLRIQPLRVQRDEAIYECTATNSLGEINTSA
KLSVLEEEQLPPGFPSIDMGPQLKVVEKARTATMLCAAGGNPDPEISWFKDFLPVDPATS
NGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVAPRFSIPPSS
QEVMPGGSVNLTCVAVGAPMPYVKWMMGAEELTKEDEMPVGRNVLELSNVVRSANYTCVA
ISSLGMIEATAQVTVKALPKPPIDLVVTETTATSVTLTWDSGNSEPVTYYGIQYRAAGTE
GPFQEVDGVATTRYSIGGLSPFSEYAFRVLAVNSIGRGPPSEAVRARTGEQAPSSPPRRV
QARMLSASTMLVQWEPPEEPNGLVRGYRVYYTPDSRRPPNAWHKHNTDAGLLTTVGSLLP
GITYSLRVLAFTAVGDGPPSPTIQVKTQQGVPAQPADFQAEVESDTRIQLSWLLPPQERI
IMYELVYWAAEDEDQQHKVTFDPTSSYTLEDLKPDTLYRFQLAARSDMGVGVFTPTIEAR
TAQSTPSAPPQKVMCVSMGSTTVRVSWVPPPADSRNGVITQYSVAYEAVDGEDRGRHVVD
GISREHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDEDVPSGPPRKVEVEPL
NSTAVHVYWKLPVPSKQHGQIRGYQVTYVRLENGEPRGLPIIQDVMLAEAQWRPEESEDY
ETTISGLTPETTYSVTVAAYTTKGDGARSKPKIVTTTGAVPGRPTMMISTTAMNTALLQW
HPPKELPGELLGYRLQYCRADEARPNTIDFGKDDQHFTVTGLHKGTTYIFRLAAKNRAGL
GEEFEKEIRTPEDLPSGFPQNLHVTGLTTSTTELAWDPPVLAERNGRIISYTVVFRDINS
QQELQNITTDTRFTLTGLKPDTTYDIKVRAWTSKGSGPLSPSIQSRTMPVEQVFAKNFRV
AAAMKTSVLLSWEVPDSYKSAVPFKILYNGQSVEVDGHSMRKLIADLQPNTEYSFVLMNR
GSSAGGLQHLVSIRTAPDLLPHKPLPASAYIEDGRFDLSMPHVQDPSLVRWFYIVVVPID
RVGGSMLTPRWSTPEELELDELLEAIEQGGEEQRRRRRQAERLKPYVAAQLDVLPETFTL
GDKKNYRGFYNRPLSPDLSYQCFVLASLKEPMDQKRYASSPYSDEIVVQVTPAQQQEEPE
MLWVTGPVLAVILIILIVIAILLFKRKRTHSPSSKDEQSIGLKDSLLAHSSDPVEMRRLN
YQTPGMRDHPPIPITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKNR
YANVIAYDHSRVILTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWE
QRTATVVMMTRLEEKSRVKCDQYWPARGTETCGLIQVTLLDTVELATYTVRTFALHKSGS
SEKRELRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIV
IDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAATCGHTEVPARNL
YAHIQKLGQVPPGESVTAMELEFKLLASSKAHTSRFISANLPCNKFKNRLVNIMPYELTR
VCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTK
LREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQF
TDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMR
YEGVVDMFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHYAT
GenBank ID Protein 109633041
UniProtKB/Swiss-Prot ID P10586
UniProtKB/Swiss-Prot Entry Name PTPRF_HUMAN
PDB IDs
GenBank Gene ID NM_002840.3
GeneCard ID PTPRF
GenAtlas ID PTPRF
HGNC ID HGNC:9670
References
General References
  1. Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD: Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins. Nat Biotechnol. 2009 Apr;27(4):378-86. doi: 10.1038/nbt.1532. Epub 2009 Apr 6. [PubMed:19349973 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  4. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952 ]
  5. Streuli M, Krueger NX, Thai T, Tang M, Saito H: Distinct functional roles of the two intracellular phosphatase like domains of the receptor-linked protein tyrosine phosphatases LCA and LAR. EMBO J. 1990 Aug;9(8):2399-407. [PubMed:1695146 ]
  6. Serra-Pages C, Medley QG, Tang M, Hart A, Streuli M: Liprins, a family of LAR transmembrane protein-tyrosine phosphatase-interacting proteins. J Biol Chem. 1998 Jun 19;273(25):15611-20. [PubMed:9624153 ]
  7. Streuli M, Krueger NX, Hall LR, Schlossman SF, Saito H: A new member of the immunoglobulin superfamily that has a cytoplasmic region homologous to the leukocyte common antigen. J Exp Med. 1988 Nov 1;168(5):1523-30. [PubMed:2972792 ]
  8. Homma K, Kikuno RF, Nagase T, Ohara O, Nishikawa K: Alternative splice variants encoding unstable protein domains exist in the human brain. J Mol Biol. 2004 Nov 5;343(5):1207-20. [PubMed:15491607 ]
  9. Streuli M, Krueger NX, Tsai AY, Saito H: A family of receptor-linked protein tyrosine phosphatases in humans and Drosophila. Proc Natl Acad Sci U S A. 1989 Nov;86(22):8698-702. [PubMed:2554325 ]
  10. Nam HJ, Poy F, Krueger NX, Saito H, Frederick CA: Crystal structure of the tandem phosphatase domains of RPTP LAR. Cell. 1999 May 14;97(4):449-57. [PubMed:10338209 ]