Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08945
Secondary Accession Numbers
  • 14674
  • HMDBP10093
Name Receptor-type tyrosine-protein phosphatase eta
Synonyms
  1. CD148 antigen
  2. DEP-1
  3. Density-enhanced phosphatase 1
  4. HPTP eta
  5. Protein-tyrosine phosphatase eta
  6. Protein-tyrosine phosphatase receptor type J
  7. R-PTP-J
  8. R-PTP-eta
Gene Name PTPRJ
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function Tyrosine phosphatase which dephosphorylates or contributes to the dephosphorylation of CTNND1, FLT3, PDGFRB, MET, RET (variant MEN2A), KDR, LYN, SRC, MAPK1, MAPK3, EGFR, TJP1, OCLN, PIK3R1 and PIK3R2. Plays a role in cell adhesion, migration, proliferation and differentiation. Involved in vascular development. Regulator of macrophage adhesion and spreading. Positively affects cell-matrix adhesion. Positive regulator of platelet activation and thrombosis. Negative regulator of cell proliferation. Negative regulator of PDGF-stimulated cell migration; through dephosphorylation of PDGFR. Positive regulator of endothelial cell survival, as well as of VEGF-induced SRC and AKT activation; through KDR dephosphorylation. Negative regulator of EGFR signaling pathway; through EGFR dephosphorylation. Enhances the barrier function of epithelial junctions during reassembly. Negatively regulates T-cell receptor (TCR) signaling. Upon T-cell TCR activation, it is up-regulated and excluded from the immunological synapses, while upon T-cell-antigen presenting cells (APC) disengagement, it is no longer excluded and can dephosphorylate PLCG1 and LAT to down-regulate prolongation of signaling.
Pathways
  • Adherens junction
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
GO Classification
Biological Process
negative regulation of MAP kinase activity
negative regulation of protein kinase B signaling cascade
heart development
negative regulation of epidermal growth factor receptor signaling pathway
contact inhibition
positive regulation of protein kinase B signaling cascade
negative regulation of platelet-derived growth factor receptor signaling pathway
positive chemotaxis
negative regulation of cell migration
negative regulation of cell growth
platelet-derived growth factor receptor signaling pathway
vasculogenesis
negative regulation of cell proliferation
negative regulation of T cell receptor signaling pathway
negative regulation of vascular permeability
positive regulation of focal adhesion assembly
Cellular Component
cell surface
cell-cell junction
ruffle membrane
immunological synapse
integral to plasma membrane
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
Molecular Function
protein tyrosine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location 11
Locus 11p11.2
SNPs PTPRJ
Gene Sequence
>4014 bp
ATGAAGCCGGCGGCGCGGGAGGCGCGGCTGCCTCCGCGCTCGCCCGGGCTGCGCTGGGCG
CTGCCGCTGCTGCTGCTGCTGCTGCGCCTGGGCCAGATCCTGTGCGCAGGTGGCACCCCT
AGTCCAATTCCTGACCCTTCAGTAGCAACTGTTGCCACAGGGGAAAATGGCATAACGCAG
ATCAGCAGTACAGCAGAATCCTTTCATAAACAGAATGGAACTGGAACACCTCAGGTGGAA
ACAAACACCAGTGAGGATGGTGAAAGCTCTGGAGCCAACGATAGTTTAAGAACACCTGAA
CAAGGATCTAATGGGACTGATGGGGCATCTCAAAAAACTCCCAGTAGCACTGGGCCCAGT
CCTGTGTTTGACATTAAAGCTGTTTCCATCAGTCCAACCAATGTGATCTTAACTTGGAAA
AGTAATGACACAGCTGCTTCTGAGTACAAGTATGTAGTAAAGCATAAGATGGAAAATGAG
AAGACAATTACTGTTGTGCATCAACCATGGTGTAACATCACAGGCTTACGTCCAGCGACT
TCATATGTATTCTCCATCACTCCAGGAATAGGCAATGAGACTTGGGGAGATCCCAGAGTC
ATAAAAGTCATCACAGAGCCGATCCCAGTTTCTGATCTCCGTGTTGCCCTCACGGGTGTG
AGGAAGGCTGCTCTCTCCTGGAGCAATGGCAATGGCACTGCCTCCTGCCGGGTTCTTCTT
GAAAGCATTGGAAGCCATGAGGAGTTGACTCAAGACTCAAGACTTCAGGTCAATATCTCG
GGCCTGAAGCCAGGGGTTCAATACAACATCAACCCGTATCTTCTACAATCAAATAAGACA
AAGGGAGACCCCTTGGGCACAGAAGGTGGCTTGGATGCCAGCAATACAGAGAGAAGCCGG
GCAGGGAGCCCCACCGCCCCTGTGCATGATGAGTCCCTCGTGGGACCTGTGGACCCATCC
TCCGGCCAGCAGTCCCGAGACACGGAAGTCCTGCTTGTCGGGTTAGAGCCTGGCACCCGA
TACAATGCCACCGTTTATTCCCAAGCAGCGAATGGCACAGAAGGACAGCCCCAGGCCATA
GAGTTCAGGACAAATGCTATTCAGGTTTTTGACGTCACCGCTGTGAACATCAGTGCCACA
AGCCTGACCCTGATCTGGAAAGTCAGCGATAACGAGTCGTCATCTAACTATACCTACAAG
ATACATGTGGCGGGGGAGACAGATTCTTCCAATCTCAACGTCAGTGAGCCTCGCGCTGTC
ATCCCCGGACTCCGCTCCAGCACCTTCTACAACATCACAGTGTGTCCTGTCCTAGGTGAC
ATCGAGGGCACGCCGGGCTTCCTCCAAGTGCACACCCCCCCTGTTCCAGTTTCTGACTTC
CGAGTGACAGTGGTCAGCACGACGGAGATCGGCTTAGCATGGAGCAGCCATGATGCAGAA
TCATTTCAGATGCATATCACACAGGAGGGAGCTGGCAATTCTCGGGTAGAAATAACCACC
AACCAAAGTATTATCATTGGTGGCTTGTTCCCTGGAACCAAGTATTGCTTTGAAATAGTT
CCAAAAGGACCAAATGGGACTGAAGGGGCATCTCGGACAGTTTGCAATAGAACTGTTCCC
AGTGCAGTGTTTGACATCCACGTGGTCTACGTCACCACCACGGAGATGTGGCTGGACTGG
AAGAGCCCTGACGGTGCTTCCGAGTATGTCTACCATTTAGTCATAGAGTCCAAGCATGGC
TCTAACCACACAAGCACGTATGACAAAGCGATTACTCTCCAGGGCCTGATTCCGGGCACC
TTATATAACATCACCATCTCTCCAGAAGTGGACCACGTCTGGGGGGACCCCAACTCCACT
GCACAGTACACACGGCCCAGCAATGTGTCCAACATTGATGTAAGTACCAACACCACAGCA
GCAACTTTAAGTTGGCAGAACTTTGATGACGCCTCTCCCACGTACTCCTACTGCCTTCTT
ATTGAGAAGGCTGGAAATTCCAGCAACGCAACACAAGTAGTCACGGACATTGGAATTACT
GACGCTACAGTCACTGAATTAATACCTGGCTCATCATACACAGTGGAGATCTTTGCACAA
GTAGGGGATGGGATCAAGTCACTGGAACCTGGCCGGAAGTCATTCTGTACAGATCCTGCG
TCCATGGCCTCCTTCGACTGCGAAGTGGTCCCCAAAGAGCCAGCCCTGGTTCTCAAATGG
ACCTGCCCTCCTGGCGCCAATGCAGGCTTTGAGCTGGAGGTCAGCAGTGGAGCCTGGAAC
AATGCGACCCACCTGGAGAGCTGCTCCTCTGAGAATGGCACTGAGTATAGAACGGAAGTC
ACGTATTTGAATTTTTCTACCTCGTACAACATCAGCATCACCACTGTGTCCTGTGGAAAG
ATGGCAGCCCCCACCCGGAACACCTGCACTACTGGCATCACAGATCCCCCTCCTCCAGAT
GGATCCCCTAATATTACATCTGTCAGTCACAATTCAGTAAAGGTCAAGTTCAGTGGATTT
GAAGCCAGCCACGGACCCATCAAAGCCTATGCTGTCATTCTCACCACCGGGGAAGCTGGT
CACCCTTCTGCAGATGTCCTGAAATACACGTATGAGGATTTCAAAAAGGGAGCCTCAGAT
ACTTATGTGACATACCTCATAAGAACAGAAGAAAAGGGACGTTCTCAGAGCTTGTCTGAA
GTTTTGAAATATGAAATTGACGTTGGGAATGAGTCAACCACACTTGGTTATTACAATGGG
AAGCTGGAACCTCTGGGCTCCTACCGGGCTTGTGTGGCTGGCTTCACCAACATTACCTTC
CACCCTCAAAACAAGGGGCTCATTGATGGGGCTGAGAGCTATGTGTCCTTCAGTCGCTAC
TCAGATGCTGTTTCCTTGCCCCAGGATCCAGGTGTCATCTGTGGAGCGGTTTTTGGCTGT
ATCTTTGGTGCCCTGGTTATTGTGACTGTGGGAGGCTTCATCTTCTGGAGAAAGAAGAGG
AAAGATGCAAAGAATAATGAAGTGTCCTTTTCTCAAATTAAACCTAAAAAATCTAAGTTA
ATCAGAGTGGAGAATTTTGAGGCCTACTTCAAGAAGCAGCAAGCTGACTCCAACTGTGGG
TTCGCAGAGGAATACGAAGATCTGAAGCTTGTTGGAATTAGTCAACCTAAATATGCAGCA
GAACTGGCTGAGAATAGAGGAAAGAATCGCTATAATAATGTTCTGCCCTATGATATTTCC
CGTGTCAAACTTTCGGTCCAGACCCATTCAACGGATGACTACATCAATGCCAACTACATG
CCTGGCTACCACTCCAAGAAAGATTTTATTGCCACACAAGGACCTTTACCGAACACTTTG
AAAGATTTTTGGCGTATGGTTTGGGAGAAAAATGTATATGCCATCATTATGTTGACTAAA
TGTGTTGAACAGGGAAGAACCAAATGTGAGGAGTATTGGCCCTCCAAGCAGGCTCAGGAC
TATGGAGACATAACTGTGGCAATGACATCAGAAATTGTTCTTCCGGAATGGACCATCAGA
GATTTCACAGTGAAAAATATCCAGACAAGTGAGAGTCACCCTCTGAGACAGTTCCATTTC
ACCTCCTGGCCAGACCACGGTGTTCCCGACACCACTGACCTGCTCATCAACTTCCGGTAC
CTCGTTCGTGACTACATGAAGCAGAGTCCTCCCGAATCGCCGATTCTGGTGCATTGCAGT
GCTGGGGTCGGAAGGACGGGCACTTTCATTGCCATTGATCGTCTCATCTACCAGATAGAG
AATGAGAACACCGTGGATGTGTATGGGATTGTGTATGACCTTCGAATGCATAGGCCTTTA
ATGGTGCAGACAGAGGACCAGTATGTTTTCCTCAATCAGTGTGTTTTGGATATTGTCAGA
TCCCAGAAAGACTCAAAAGTAGATCTTATCTACCAGAACACAACTGCAATGACAATCTAT
GAAAACCTTGCGCCCGTGACCACATTTGGAAAGACCAATGGTTACATCGCCTAA
Protein Properties
Number of Residues 1337
Molecular Weight 57189.34
Theoretical pI 5.608
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Receptor-type tyrosine-protein phosphatase eta
MKPAAREARLPPRSPGLRWALPLLLLLLRLGQILCAGGTPSPIPDPSVATVATGENGITQ
ISSTAESFHKQNGTGTPQVETNTSEDGESSGANDSLRTPEQGSNGTDGASQKTPSSTGPS
PVFDIKAVSISPTNVILTWKSNDTAASEYKYVVKHKMENEKTITVVHQPWCNITGLRPAT
SYVFSITPGIGNETWGDPRVIKVITEPIPVSDLRVALTGVRKAALSWSNGNGTASCRVLL
ESIGSHEELTQDSRLQVNISGLKPGVQYNINPYLLQSNKTKGDPLGTEGGLDASNTERSR
AGSPTAPVHDESLVGPVDPSSGQQSRDTEVLLVGLEPGTRYNATVYSQAANGTEGQPQAI
EFRTNAIQVFDVTAVNISATSLTLIWKVSDNESSSNYTYKIHVAGETDSSNLNVSEPRAV
IPGLRSSTFYNITVCPVLGDIEGTPGFLQVHTPPVPVSDFRVTVVSTTEIGLAWSSHDAE
SFQMHITQEGAGNSRVEITTNQSIIIGGLFPGTKYCFEIVPKGPNGTEGASRTVCNRTVP
SAVFDIHVVYVTTTEMWLDWKSPDGASEYVYHLVIESKHGSNHTSTYDKAITLQGLIPGT
LYNITISPEVDHVWGDPNSTAQYTRPSNVSNIDVSTNTTAATLSWQNFDDASPTYSYCLL
IEKAGNSSNATQVVTDIGITDATVTELIPGSSYTVEIFAQVGDGIKSLEPGRKSFCTDPA
SMASFDCEVVPKEPALVLKWTCPPGANAGFELEVSSGAWNNATHLESCSSENGTEYRTEV
TYLNFSTSYNISITTVSCGKMAAPTRNTCTTGITDPPPPDGSPNITSVSHNSVKVKFSGF
EASHGPIKAYAVILTTGEAGHPSADVLKYTYEDFKKGASDTYVTYLIRTEEKGRSQSLSE
VLKYEIDVGNESTTLGYYNGKLEPLGSYRACVAGFTNITFHPQNKGLIDGAESYVSFSRY
SDAVSLPQDPGVICGAVFGCIFGALVIVTVGGFIFWRKKRKDAKNNEVSFSQIKPKKSKL
IRVENFEAYFKKQQADSNCGFAEEYEDLKLVGISQPKYAAELAENRGKNRYNNVLPYDIS
RVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWRMVWEKNVYAIIMLTK
CVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHF
TSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIE
NENTVDVYGIVYDLRMHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIYQNTTAMTIY
ENLAPVTTFGKTNGYIA
GenBank ID Protein 148728162
UniProtKB/Swiss-Prot ID Q12913
UniProtKB/Swiss-Prot Entry Name PTPRJ_HUMAN
PDB IDs
GenBank Gene ID NM_002843.3
GeneCard ID PTPRJ
GenAtlas ID PTPRJ
HGNC ID HGNC:9673
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  4. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952 ]
  5. Honda H, Shibuya M, Chiba S, Yazaki Y, Hirai H: Identification of novel protein-tyrosine phosphatases in a human leukemia cell line, F-36P. Leukemia. 1993 May;7(5):742-6. [PubMed:8483328 ]
  6. Ostman A, Yang Q, Tonks NK: Expression of DEP-1, a receptor-like protein-tyrosine-phosphatase, is enhanced with increasing cell density. Proc Natl Acad Sci U S A. 1994 Oct 11;91(21):9680-4. [PubMed:7937872 ]
  7. Honda H, Inazawa J, Nishida J, Yazaki Y, Hirai H: Molecular cloning, characterization, and chromosomal localization of a novel protein-tyrosine phosphatase, HPTP eta. Blood. 1994 Dec 15;84(12):4186-94. [PubMed:7994032 ]
  8. Ruivenkamp CA, van Wezel T, Zanon C, Stassen AP, Vlcek C, Csikos T, Klous AM, Tripodis N, Perrakis A, Boerrigter L, Groot PC, Lindeman J, Mooi WJ, Meijjer GA, Scholten G, Dauwerse H, Paces V, van Zandwijk N, van Ommen GJ, Demant P: Ptprj is a candidate for the mouse colon-cancer susceptibility locus Scc1 and is frequently deleted in human cancers. Nat Genet. 2002 Jul;31(3):295-300. Epub 2002 Jun 24. [PubMed:12089527 ]