Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08952
Secondary Accession Numbers
  • 14681
Name Receptor-type tyrosine-protein phosphatase U
Synonyms
  1. PCP-2
  2. PTP pi
  3. PTP-J
  4. PTP-RO
  5. Pancreatic carcinoma phosphatase 2
  6. Protein-tyrosine phosphatase J
  7. Protein-tyrosine phosphatase pi
  8. Protein-tyrosine phosphatase receptor omicron
  9. R-PTP-U
  10. R-PTP-psi
  11. Receptor-type protein-tyrosine phosphatase psi
  12. hPTP-J
Gene Name PTPRU
Protein Type Enzyme
Biological Properties
General Function Involved in phosphatase activity
Specific Function Tyrosine-protein phosphatase which dephosphorylates CTNNB1. Regulates CTNNB1 function both in cell adhesion and signaling. May function in cell proliferation and migration and play a role in the maintenance of epithelial integrity. May play a role in megakaryocytopoiesis.
Pathways Not Available
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
GO Classification
Biological Process
homotypic cell-cell adhesion
transmembrane receptor protein tyrosine phosphatase signaling pathway
canonical Wnt receptor signaling pathway
protein localization to cell surface
cell differentiation
negative regulation of cell migration
cell-cell adhesion
negative regulation of cell proliferation
Cellular Component
cell-cell junction
integral to plasma membrane
Component
membrane
cell part
Function
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
hydrolase activity, acting on ester bonds
catalytic activity
hydrolase activity
phosphoric ester hydrolase activity
phosphatase activity
Molecular Function
transmembrane receptor protein tyrosine phosphatase activity
Process
phosphorus metabolic process
phosphate metabolic process
dephosphorylation
protein amino acid dephosphorylation
metabolic process
cellular metabolic process
Cellular Location
  1. Cell membrane
  2. Single-pass type I membrane protein
  3. Cell junction
Gene Properties
Chromosome Location 1
Locus 1p35.3
SNPs PTPRU
Gene Sequence
>4341 bp
ATGGCCCGTGCCCAGGCGCTCGTGCTGGCACTCACCTTCCAGCTCTGCGCGCCGGAGACC
GAGACTCCGGCAGCTGGCTGCACCTTCGAGGAGGCAAGTGACCCAGCAGTGCCCTGCGAG
TACAGCCAGGCCCAGTACGATGACTTCCAGTGGGAGCAAGTGCGAATCCACCCTGGCACC
CGGGCACCTGCGGACCTGCCCCACGGCTCCTACTTGATGGTCAACACTTCCCAGCATGCC
CCAGGCCAGCGAGCCCATGTCATCTTCCAGAGCCTGAGCGAGAATGATACCCACTGTGTG
CAGTTCAGCTACTTCCTGTACAGCCGGGACGGGCACAGCCCGGGCACCCTGGGCGTCTAC
GTGCGCGTTAATGGGGGCCCCCTGGGCAGTGCTGTGTGGAATATGACTGGATCCCACGGC
CGTCAGTGGCACCAGGCTGAGCTGGCTGTCAGCACTTTCTGGCCCAATGAATATCAGGTG
CTGTTTGAGGCCCTCATCTCCCCAGACCGCAGGGGCTACATGGGCCTAGATGACATCCTG
CTTCTCAGCTACCCCTGCGCAAAGGCCCCACACTTCTCCCGCCTGGGCGACGTGGAGGTC
AACGCGGGCCAGAACGCGTCGTTCCAGTGCATGGCCGCGGGCAGAGCGGCCGAGGCCGAA
CGCTTCCTCTTGCAACGGCAGAGCGGGGCGCTGGTGCCGGCGGCGGGCGTGCGGCACATC
AGCCACCGGCGCTTCCTGGCCACTTTCCCGCTGGCTGCCGTGAGCCGCGCCGAGCAGGAC
CTGTACCGCTGTGTGTCCCAGGCCCCGCGCGGCGCGGGCGTCTCTAACTTCGCGGAGCTC
ATCGTCAAGGAGCCCCCAACTCCCATCGCGCCCCCACAGCTGCTGCGTGCTGGCCCCACC
TACCTCATCATCCAGCTCAACACCAACTCCATCATTGGCGACGGGCCGATCGTGCGCAAG
GAGATTGAGTACCGCATGGCGCGCGGGCCCTGGGCTGAGGTGCACGCCGTCAGCCTGCAG
ACCTACAAGCTGTGGCACCTCGACCCCGACACAGAGTATGAGATCAGCGTGCTGCTCACG
CGTCCCGGAGACGGCGGCACTGGCCGCCCTGGGCCACCCCTCATCAGCCGCACCAAATGC
GCAGAGCCCATGAGGGCCCCCAAAGGCCTGGCTTTTGCTGAGATCCAGGCCCGTCAGCTG
ACCCTGCAGTGGGAACCACTGGGCTACAACGTGACGCGTTGCCACACCTATACTGTGTCG
CTGTGCTATCACTACACCCTGGGCAGCAGCCACAACCAGACCATCCGAGAGTGTGTGAAG
ACAGAGCAAGGTGTCAGCCGCTACACCATCAAGAACCTGCTGCCCTATCGGAACGTTCAC
GTGAGGCTTGTCCTCACTAACCCTGAGGGGCGCAAAGAGGGCAAGGAGGTCACTTTCCAG
ACGGATGAGGATGTGCCCAGTGGGATTGCAGCCGAGTCCCTGACCTTCACTCCACTGGAG
GACATGATCTTCCTCAAGTGGGAGGAGCCCCAGGAGCCCAATGGTCTCATCACCCAGTAT
GAGATCAGCTACCAGAGCATCGAGTCATCAGACCCGGCAGTGAACGTGCCAGGCCCACGA
CGTACCATCTCCAAGCTCCGCAATGAGACCTACCATGTCTTCTCCAACCTGCACCCAGGC
ACCACCTACCTGTTCTCCGTGCGGGCCCGCACAGGCAAAGGCTTCGGCCAGGCGGCACTC
ACTGAGATAACCACTAACATCTCTGCTCCCAGCTTTGATTATGCCGACATGCCGTCACCC
CTGGGCGAGTCTGAGAACACCATCACCGTGCTGCTGAGGCCGGCACAGGGCCGCGGTGCG
CCCATCAGTGTGTACCAGGTGATTGTGGAGGAGGAGCGGGCGCGGAGGCTGCGGCGGGAG
CCAGGTGGACAGGACTGCTTCCCAGTGCCATTGACCTTCGAGGCGGCGCTGGCCCGAGGC
CTGGTGCACTACTTCGGGGCCGAACTGGCGGCCAGCAGTCTACCTGAGGCCATGCCCTTT
ACCGTGGGTGACAACCAGACCTACCGAGGCTTCTGGAACCCACCACTTGAGCCTAGGAAG
GCCTATCTCATCTACTTCCAGGCAGCAAGCCACCTGAAGGGGGAGACCCGGCTGAATTGC
ATCCGCATTGCCAGGAAAGCTGCCTGCAAGGAAAGCAAGCGGCCCCTGGAGGTGTCCCAG
AGATCGGAGGAGATGGGGCTTATCCTGGGCATCTGTGCAGGGGGGCTTGCTGTCCTCATC
CTTCTCCTGGGTGCCATCATTGTCATCATCCGCAAAGGGAGAGACCACTATGCCTACTCC
TACTACCCGAAGCCGGTGAACATGACCAAGGCCACCGTCAACTACCGCCAGGAGAAGACA
CACATGATGAGCGCCGTGGACCGCAGCTTCACAGACCAGAGCACCCTGCAGGAGGACGAG
CGGCTGGGCCTGTCCTTCATGGACACCCATGGCTACAGCACCCGGGGAGACCAGCGCAGC
GGTGGGGTCACTGAGGCCAGCAGCCTCCTGGGGGGCTCCCCGAGGCGTCCCTGTGGCCGG
AAGGGCTCCCCATACCACACGGGGCAGCTGCACCCTGCGGTGCGTGTCGCAGACCTTCTG
CAGCACATCAACCAGATGAAGACGGCCGAGGGTTACGGCTTCAAGCAGGAGTATGAGAGC
TTCTTTGAAGGCTGGGACGCCACAAAGAAGAAAGACAAGGTCAAGGGCAGCCGGCAGGAG
CCAATGCCTGCCTATGATCGGCACCGAGTGAAACTGCACCCGATGCTGGGAGACCCCAAT
GCCGACTACATTAATGCCAACTACATAGATGGTTACCACAGGTCAAACCACTTCATAGCC
ACTCAAGGGCCGAAGCCTGAGATGGTCTATGACTTCTGGCGTATGGTGTGGCAGGAGCAC
TGTTCCAGCATCGTCATGATCACCAAGCTGGTCGAGGTGGGCAGGGTGAAATGCTCACGG
TACTGGCCGGAGGACTCAGACACCTACGGGGACATCAAGATTATGCTGGTGAAGACAGAG
ACCCTGGCTGAGTATGTCGTGCGCACTTTTGCCCTGGAGCGGAGAGGCTACTCTGCCCGG
CACGAGGTCCGCCAGTTCCACTTCACAGCGTGGCCAGAGCATGGCGTCCCCTACCATGCC
ACGGGGCTGCTGGCTTTCATCCGGCGCGTGAAGGCCTCCACCCCACCTGATGCCGGGCCC
ATTGTCATCCACTGCAGCGCGGGCACCGGCCGCACAGGTTGCTATATCGTCCTGGATGTG
ATGCTGGACATGGCAGAGTGTGAGGGCGTCGTGGACATTTACAACTGTGTGAAGACTCTC
TGCTCCCGGCGTGTCAACATGATCCAGACTGAGGAGCAGTACATCTTCATTCATGATGCA
ATCCTGGAGGCCTGCCTGTGTGGGGAGACCACCATCCCTGTCAGTGAGTTCAAGGCCACC
TACAAGGAGATGATCCGCATTGATCCTCAGAGTAATTCCTCCCAGCTGCGGGAAGAGTTC
CAGACGCTGAACTCGGTCACCCCGCCGCTGGACGTGGAGGAGTGCAGCATCGCCCTGTTG
CCCCGGAACCGCGACAAGAACCGCAGCATGGACGTCCTGCCGCCCGACCGCTGCCTGCCC
TTCCTCATCTCCACTGATGGGGACTCCAACAACTACATTAATGCAGCCCTGACTGACAGC
TACACACGGAGTGCGGCCTTCATCGTGACCCTGCACCCGCTGCAGAGCACCACGCCCGAC
TTCTGGCGGCTGGTCTACGATTACGGGTGCACCTCCATCGTCATGCTCAACCAGCTGAAC
CAGTCCAACTCCGCCTGGCCCTGCCTGCAGTACTGGCCAGAGCCAGGCCGGCAGCAATAT
GGCCTCATGGAGGTGGAGTTTATGTCGGGCACAGCTGATGAAGACTTAGTGGCTCGAGTC
TTCCGGGTGCAGAACATCTCTCGGTTGCAGGAGGGGCACCTGCTGGTGCGGCACTTCCAG
TTCCTGCGCTGGTCTGCATACCGGGACACACCTGACTCCAAGAAGGCCTTCTTGCACCTG
CTGGCTGAGGTGGACAAGTGGCAGGCCGAGAGTGGGGATGGGCGCACCATCGTGCACTGC
CTAAACGGGGGAGGACGCAGCGGCACCTTCTGCGCCTGCGCCACGGTCCTGGAGATGATC
CGCTGCCACAACTTGGTGGACGTTTTCTTTGCTGCCAAAACCCTCCGGAACTACAAACCC
AACATGGTGGAGACCATGGATCAGTACCACTTTTGCTACGATGTGGCCCTGGAGTACTTG
GAGGGGCTGGAGTCAAGATAG
Protein Properties
Number of Residues 1446
Molecular Weight 160793.34
Theoretical pI 6.861
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Receptor-type tyrosine-protein phosphatase U
MARAQALVLALTFQLCAPETETPAAGCTFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGT
RAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDGHSPGTLGVY
VRVNGGPLGSAVWNMTGSHGRQWHQAELAVSTFWPNEYQVLFEALISPDRRGYMGLDDIL
LLSYPCAKAPHFSRLGDVEVNAGQNASFQCMAAGRAAEAERFLLQRQSGALVPAAGVRHI
SHRRFLATFPLAAVSRAEQDLYRCVSQAPRGAGVSNFAELIVKEPPTPIAPPQLLRAGPT
YLIIQLNTNSIIGDGPIVRKEIEYRMARGPWAEVHAVSLQTYKLWHLDPDTEYEISVLLT
RPGDGGTGRPGPPLISRTKCAEPMRAPKGLAFAEIQARQLTLQWEPLGYNVTRCHTYTVS
LCYHYTLGSSHNQTIRECVKTEQGVSRYTIKNLLPYRNVHVRLVLTNPEGRKEGKEVTFQ
TDEDVPSGIAAESLTFTPLEDMIFLKWEEPQEPNGLITQYEISYQSIESSDPAVNVPGPR
RTISKLRNETYHVFSNLHPGTTYLFSVRARTGKGFGQAALTEITTNISAPSFDYADMPSP
LGESENTITVLLRPAQGRGAPISVYQVIVEEERARRLRREPGGQDCFPVPLTFEAALARG
LVHYFGAELAASSLPEAMPFTVGDNQTYRGFWNPPLEPRKAYLIYFQAASHLKGETRLNC
IRIARKAACKESKRPLEVSQRSEEMGLILGICAGGLAVLILLLGAIIVIIRKGRDHYAYS
YYPKPVNMTKATVNYRQEKTHMMSAVDRSFTDQSTLQEDERLGLSFMDTHGYSTRGDQRS
GGVTEASSLLGGSPRRPCGRKGSPYHTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYES
FFEGWDATKKKDKVKGSRQEPMPAYDRHRVKLHPMLGDPNADYINANYIDGYHRSNHFIA
TQGPKPEMVYDFWRMVWQEHCSSIVMITKLVEVGRVKCSRYWPEDSDTYGDIKIMLVKTE
TLAEYVVRTFALERRGYSARHEVRQFHFTAWPEHGVPYHATGLLAFIRRVKASTPPDAGP
IVIHCSAGTGRTGCYIVLDVMLDMAECEGVVDIYNCVKTLCSRRVNMIQTEEQYIFIHDA
ILEACLCGETTIPVSEFKATYKEMIRIDPQSNSSQLREEFQTLNSVTPPLDVEECSIALL
PRNRDKNRSMDVLPPDRCLPFLISTDGDSNNYINAALTDSYTRSAAFIVTLHPLQSTTPD
FWRLVYDYGCTSIVMLNQLNQSNSAWPCLQYWPEPGRQQYGLMEVEFMSGTADEDLVARV
FRVQNISRLQEGHLLVRHFQFLRWSAYRDTPDSKKAFLHLLAEVDKWQAESGDGRTIVHC
LNGGGRSGTFCACATVLEMIRCHNLVDVFFAAKTLRNYKPNMVETMDQYHFCYDVALEYL
EGLESR
GenBank ID Protein 110735402
UniProtKB/Swiss-Prot ID Q92729
UniProtKB/Swiss-Prot Entry Name PTPRU_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_005704.4
GeneCard ID PTPRU
GenAtlas ID PTPRU
HGNC ID HGNC:9683
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974 ]
  6. Taniguchi Y, London R, Schinkmann K, Jiang S, Avraham H: The receptor protein tyrosine phosphatase, PTP-RO, is upregulated during megakaryocyte differentiation and Is associated with the c-Kit receptor. Blood. 1999 Jul 15;94(2):539-49. [PubMed:10397721 ]
  7. Yan HX, He YQ, Dong H, Zhang P, Zeng JZ, Cao HF, Wu MC, Wang HY: Physical and functional interaction between receptor-like protein tyrosine phosphatase PCP-2 and beta-catenin. Biochemistry. 2002 Dec 31;41(52):15854-60. [PubMed:12501215 ]
  8. Crossland S, Smith PD, Crompton MR: Molecular cloning and characterization of PTP pi, a novel receptor-like protein-tyrosine phosphatase. Biochem J. 1996 Oct 1;319 ( Pt 1):249-54. [PubMed:8870675 ]
  9. Wang H, Lian Z, Lerch MM, Chen Z, Xie W, Ullrich A: Characterization of PCP-2, a novel receptor protein tyrosine phosphatase of the MAM domain family. Oncogene. 1996 Jun 20;12(12):2555-62. [PubMed:8700514 ]
  10. Wang B, Kishihara K, Zhang D, Hara H, Nomoto K: Molecular cloning and characterization of a novel human receptor protein tyrosine phosphatase gene, hPTP-J: down-regulation of gene expression by PMA and calcium ionophore in Jurkat T lymphoma cells. Biochem Biophys Res Commun. 1997 Feb 3;231(1):77-81. [PubMed:9070223 ]
  11. Avraham S, London R, Tulloch GA, Ellis M, Fu Y, Jiang S, White RA, Painter C, Steinberger AA, Avraham H: Characterization and chromosomal localization of PTPRO, a novel receptor protein tyrosine phosphatase, expressed in hematopoietic stem cells. Gene. 1997 Dec 19;204(1-2):5-16. [PubMed:9434160 ]
  12. Wang B, Kishihara K, Zhang D, Sakamoto T, Nomoto K: Transcriptional regulation of a receptor protein tyrosine phosphatase gene hPTP-J by PKC-mediated signaling pathways in Jurkat and Molt-4 T lymphoma cells. Biochim Biophys Acta. 1999 Jul 8;1450(3):331-40. [PubMed:10395944 ]
  13. Yan HX, Yang W, Zhang R, Chen L, Tang L, Zhai B, Liu SQ, Cao HF, Man XB, Wu HP, Wu MC, Wang HY: Protein-tyrosine phosphatase PCP-2 inhibits beta-catenin signaling and increases E-cadherin-dependent cell adhesion. J Biol Chem. 2006 Jun 2;281(22):15423-33. Epub 2006 Mar 30. [PubMed:16574648 ]
  14. Dong H, Yuan H, Jin W, Shen Y, Xu X, Wang H: Involvement of beta3A subunit of adaptor protein-3 in intracellular trafficking of receptor-like protein tyrosine phosphatase PCP-2. Acta Biochim Biophys Sin (Shanghai). 2007 Jul;39(7):540-6. [PubMed:17622474 ]