You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08961
Secondary Accession Numbers
  • 14695
Name Pyruvate kinase
Synonyms Not Available
Gene Name Not Available
Protein Type Unknown
Biological Properties
General Function Involved in magnesium ion binding
Specific Function ATP + pyruvate = ADP + phosphoenolpyruvate
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
magnesium ion binding
alkali metal ion binding
potassium ion binding
pyruvate kinase activity
Process
metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
glucose catabolic process
glycolysis
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs Not Available
Gene Sequence
>1764 bp
CATTCCATGGTCCCGCAGCCCCAGGCCCACACTGAAAGCATGTCGATCCAGGAGAACATA
TCATCCCTGCAGCTTCGGTCATGGGTCTCTAAGTCCCAAAGAGACTTAGCAAAGTCCATC
CTGATTGGGGCTCCAGGAGGGCCAGCGGGGTATCTGCGGCGGGCCAGTGTGGCCCAACTG
ACCCAGGAGCTGGGCACTGCCTTCTTCCAGCAGCAGCAGCTGCCAGCTGCTATGGCAGAC
ACCTTCCTGGAACACCTCTGCCTACTGGACATTGACTCCGAGCCCGTGGCTGCTCGCAGT
ACCAGCATCATTGCCACCATCGGGCCAGCATCTCGCTCCGTGGAGCGCCTCAAGGAGATG
ATCAAGGCCGGGATGAACATTGCGCGACTCAACTTCTCCCACGGCTCCCACGAGTACCAT
GCTGAGTCCATCGCCAACGTCCGGGAGGCGGTGGAGAGCTTTGCAGGTTCCCCACTCAGC
TACCGGCCCGTGGCCATCGCCCTGGACACCAAGGGACCGGAGATCCGCACTGGGATCCTG
CAGGGGGGTCCAGAGTCGGAAGTGGAGCTGGTGAAGGGCTCCCAGGTGCTGGTGACTGTG
GACCCCGCGTTCCGGACGCGGGGGAACGCGAACACCGTGTGGGTGGACTACCCCAATATT
GTCCGGGTCGTGCCGGTGGGGGGCCGCATCTACATTGACGACGGGCTCATCTCCCTAGTG
GTCCAGAAAATCGGCCCAGAGGGACTGGTGACCCAAGTGGAGAACGGCGGCGTCCTGGGC
AGCCGGAAGGGCGTGAACTTGCCAGGGGCCCAGGTGGACTTGCCCGGGCTGTCCGAGCAG
GACGTCCGAGACCTGCGCTTCGGGGTGGAGCATGGGGTGGACATCGTCTTTGCCTCCTTT
GTGCGGAAAGCCAGCGACGTGGCTGCCGTCAGGGCTGCTCTGGGTCCGGAAGGACACGGC
ATCAAGATCATCAGCAAAATTGAGAACCACGAAGGCGTGAAGAGGTTTGATGAAATCCTG
GAGGTGAGCGACGGCATCATGGTGGCACGGGGGGACCTAGGCATCGAGATCCCAGCAGAG
AAGGTTTTCCTGGCTCAGAAGATGATGATTGGGCGCTGCAACTTGGCGGGCAAGCCTGTT
GTCTGTGCCACACAGATGCTGGAGAGCATGATTACCAAGCCCCGGCCAACGAGGGCAGAG
ACAAGCGATGTCGCCAATGCTGTGCTGGATGGGGCTGACTGCATCATGCTGTCAGGGGAG
ACTGCCAAGGGCAACTTCCCTGTGGAAGCGGTGAAGATGCAGCATGCGATTGCCCGGGAG
GCAGAGGCCGCAGTGTACCACCGGCAGCTGTTTGAGGAGCTACGTCGGGCAGCGCCACTA
AGCCGTGATCCCACTGAGGTCACCGCCATTGGTGCTGTGGAGGCTGCCTTCAAGTGCTGT
GCTGCTGCCATCATTGTGCTGACCACAACTGGCCGCTCAGCCCAGCTTCTGTCTCGGTAC
CGACCTCGGGCAGCAGTCATTGCTGTCACCCGCTCTGCCCAGGCTGCCCGCCAGGTCCAC
TTATGCCGAGGAGTCTTCCCCTTGCTTTACCGTGAACCTCCAGAAGCCATCTGGGCAGAT
GATGTAGATCGCCGGGTGCAATTTGGCATTGAAAGTGGAAAGCTCCGTGGCTTCCTCCGT
GTTGGAGACCTGGTGATTGTGGTGACAGGCTGGCGACCTGGCTCCGGCTACACCAACATC
ATGCGGGTGCTAAGCATATCCTGA
Protein Properties
Number of Residues 587
Molecular Weight 63260.1
Theoretical pI 7.6
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Pyruvate kinase
HSMVPQPQAHTESMSIQENISSLQLRSWVSKSQRDLAKSILIGAPGGPAGYLRRASVAQL
TQELGTAFFQQQQLPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVERLKEM
IKAGMNIARLNFSHGSHEYHAESIANVREAVESFAGSPLSYRPVAIALDTKGPEIRTGIL
QGGPESEVELVKGSQVLVTVDPAFRTRGNANTVWVDYPNIVRVVPVGGRIYIDDGLISLV
VQKIGPEGLVTQVENGGVLGSRKGVNLPGAQVDLPGLSEQDVRDLRFGVEHGVDIVFASF
VRKASDVAAVRAALGPEGHGIKIISKIENHEGVKRFDEILEVSDGIMVARGDLGIEIPAE
KVFLAQKMMIGRCNLAGKPVVCATQMLESMITKPRPTRAETSDVANAVLDGADCIMLSGE
TAKGNFPVEAVKMQHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIGAVEAAFKCC
AAAIIVLTTTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWAD
DVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLSIS
GenBank ID Protein 1230589
UniProtKB/Swiss-Prot ID Q16715
UniProtKB/Swiss-Prot Entry Name Q16715_HUMAN
PDB IDs
GenBank Gene ID U47654
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:9020
References
General References
  1. Lenzner C, Nurnberg P, Jacobasch G, Thiele BJ: Complete genomic sequence of the human PK-L/R-gene includes four intragenic polymorphisms defining different haplotype backgrounds of normal and mutant PK-genes. DNA Seq. 1997;8(1-2):45-53. [PubMed:9522120 ]