You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP08966
Secondary Accession Numbers
  • 14700
Name 5-phosphohydroxy-L-lysine phospho-lyase
Synonyms
  1. Alanine--glyoxylate aminotransferase 2-like 2
Gene Name AGXT2L2
Protein Type Enzyme
Biological Properties
General Function Involved in transaminase activity
Specific Function Catalyzes the pyridoxal-phosphate-dependent breakdown of 5-phosphohydroxy-L-lysine, converting it to ammonia, inorganic phosphate and 2-aminoadipate semialdehyde.
Pathways Not Available
Reactions
5-phosphonooxy-L-lysine + Water → Allysine + Ammonia + Phosphate details
GO Classification
Biological Process
metabolic process
Cellular Component
mitochondrion
Function
binding
catalytic activity
transferase activity
transferase activity, transferring nitrogenous groups
cofactor binding
pyridoxal phosphate binding
transaminase activity
Molecular Function
pyridoxal phosphate binding
transaminase activity
lyase activity
Cellular Location
  1. Mitochondrion (Potential)
Gene Properties
Chromosome Location 5
Locus 5q35.3
SNPs AGXT2L2
Gene Sequence
>1353 bp
ATGGCCGCAGACCAGCGCCCGAAGGCCGACACGCTGGCCCTGAGGCAACGGCTCATCAGC
TCTTCCTGCAGACTCTTTTTTCCCGAGGATCCTGTTAAGATTGTCCGGGCCCAAGGGCAG
TACATGTACGATGAACAGGGGGCAGAATACATCGATTGCATCAGCAATGTGGCGCACGTT
GGGCACTGCCACCCTCTCGTGGTCCAAGCAGCACATGAGCAGAACCAGGTGCTCAACACC
AACAGCCGGTACCTGCATGACAACATCGTGGACTATGCGCAGAGGCTGTCAGAGACCCTG
CCGGAGCAGCTCTGTGTGTTCTATTTCCTGAATTCTGGGTCAGAAGCCAATGACCTGGCC
CTGAGGCTGGCTCGCCACTACACGGGACACCAGGACGTGGTGGTATTAGATCATGCGTAT
CACGGCCACCTGAGCTCCCTGATTGACATCAGTCCCTACAAGTTCCGCAACCTGGATGGC
CAGAAGGAGTGGGTCCACGTGGCACCTCTCCCAGACACCTACCGGGGCCCCTACCGGGAG
GACCACCCCAACCCAGCTATGGCCTATGCCAACGAGGTGAAACGTGTGGTCAGCAGTGCA
CAGGAGAAGGGCAGGAAGATTGCAGCCTTCTTCGCTGAGTCTCTGCCCAGTGTGGGAGGG
CAGATCATTCCCCCTGCTGGCTACTTCTCCCAAGTGGCAGAGCACATCCGCAAGGCCGGA
GGGGTCTTTGTTGCAGATGAGATCCAGGTTGGCTTTGGCCGGGTAGGCAAGCACTTCTGG
GCCTTCCAGCTCCAGGGAAAAGACTTCGTCCCTGACATCGTCACCATGGGCAAGTCCATT
GGCAACGGCCACCCTGTTGCCTGCGTGGCCGCAACCCAGCCTGTGGCGAGGGCATTTGAA
GCCACCGGCGTTGAGTACTTCAACACGTTTGGGGGCAGCCCAGTGTCCTGCGCTGTGGGG
CTGGCCGTCCTGAATGTCTTGGAGAAGGAGCAGCTCCAGGATCATGCCACCAGTGTAGGC
AGCTTCCTGATGCAGCTCCTCGGGCAGCAAAAAATCAAACATCCCATCGTCGGGGATGTC
AGGGGTGTTGGGCTCTTCATTGGTGTGGATCTGATCAAAGATGAGGCCACAAGGACACCA
GCAACTGAAGAGGCTGCCTACTTGGTATCAAGGCTGAAGGAGAACTACGTTTTGCTGAGC
ACTGATGGCCCTGGGAGGAACATCCTGAAGTTTAAGCCCCCAATGTGCTTCAGCCTGGAC
AATGCACGGCAGGTGGTGGCAAAGCTGGATGCCATTCTGACTGACATGGAAGAGAAGGTG
AGAAGTTGTGAAACGCTGAGGCTCCAGCCCTAA
Protein Properties
Number of Residues 450
Molecular Weight 49710.245
Theoretical pI 6.763
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Alanine--glyoxylate aminotransferase 2-like 2
MAADQRPKADTLALRQRLISSSCRLFFPEDPVKIVRAQGQYMYDEQGAEYIDCISNVAHV
GHCHPLVVQAAHEQNQVLNTNSRYLHDNIVDYAQRLSETLPEQLCVFYFLNSGSEANDLA
LRLARHYTGHQDVVVLDHAYHGHLSSLIDISPYKFRNLDGQKEWVHVAPLPDTYRGPYRE
DHPNPAMAYANEVKRVVSSAQEKGRKIAAFFAESLPSVGGQIIPPAGYFSQVAEHIRKAG
GVFVADEIQVGFGRVGKHFWAFQLQGKDFVPDIVTMGKSIGNGHPVACVAATQPVARAFE
ATGVEYFNTFGGSPVSCAVGLAVLNVLEKEQLQDHATSVGSFLMQLLGQQKIKHPIVGDV
RGVGLFIGVDLIKDEATRTPATEEAAYLVSRLKENYVLLSTDGPGRNILKFKPPMCFSLD
NARQVVAKLDAILTDMEEKVRSCETLRLQP
GenBank ID Protein 24119277
UniProtKB/Swiss-Prot ID Q8IUZ5
UniProtKB/Swiss-Prot Entry Name AT2L2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_153373.2
GeneCard ID AGXT2L2
GenAtlas ID AGXT2L2
HGNC ID HGNC:28249
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Wan D, Gong Y, Qin W, Zhang P, Li J, Wei L, Zhou X, Li H, Qiu X, Zhong F, He L, Yu J, Yao G, Jiang H, Qian L, Yu Y, Shu H, Chen X, Xu H, Guo M, Pan Z, Chen Y, Ge C, Yang S, Gu J: Large-scale cDNA transfection screening for genes related to cancer development and progression. Proc Natl Acad Sci U S A. 2004 Nov 2;101(44):15724-9. Epub 2004 Oct 21. [PubMed:15498874 ]