You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09007
Secondary Accession Numbers
  • 14748
Name Histone-lysine N-methyltransferase ASH1L
Synonyms
  1. ASH1-like protein
  2. Absent small and homeotic disks protein 1 homolog
  3. Lysine N-methyltransferase 2H
  4. huASH1
Gene Name ASH1L
Protein Type Unknown
Biological Properties
General Function Involved in DNA binding
Specific Function Histone methyltransferase specifically methylating 'Lys-36' of histone H3 (H3K36me).
Pathways
  • Lysine degradation
  • Tight junction
Reactions
S-Adenosylmethionine + L-lysine-[histone] → S-Adenosylhomocysteine + N(6)-methyl-L-lysine-[histone] details
Protein lysine + S-Adenosylmethionine → Protein N6-methyl-L-lysine + S-Adenosylhomocysteine details
S-Adenosylmethionine + Protein N6-methyl-L-lysine → S-Adenosylhomocysteine + Protein N6,N6-dimethyl-L-lysine details
S-Adenosylmethionine + Protein N6,N6-dimethyl-L-lysine → S-Adenosylhomocysteine + Protein N6,N6,N6-trimethyl-L-lysine details
GO Classification
Biological Process
cell-cell signaling
DNA packaging
histone lysine methylation
transcription from RNA polymerase II promoter
regulation of transcription, DNA-dependent
Cellular Component
chromosome
Golgi apparatus
nucleus
tight junction
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
zinc ion binding
transferase activity
protein binding
protein methyltransferase activity
protein-lysine n-methyltransferase activity
histone-lysine n-methyltransferase activity
nucleic acid binding
dna binding
transferase activity, transferring one-carbon groups
methyltransferase activity
Molecular Function
histone-lysine N-methyltransferase activity
metal ion binding
zinc ion binding
DNA binding
Cellular Location
  1. Nucleus
  2. Chromosome (Probable)
  3. Cell junction
  4. tight junction
Gene Properties
Chromosome Location 1
Locus 1q22
SNPs ASH1L
Gene Sequence
>8910 bp
ATGGACCCTAGAAATACTGCTATGTTAGGATTGGGTTCTGATTCCGAAGGTTTTTCAAGA
AAGAGTCCTTCTGCCATCAGTACTGGCACATTGGTCAGTAAGAGAGAAGTAGAGCTAGAA
AAAAACACAAAGGAGGAAGAGGACCTTCGCAAACGGAATCGAGAAAGAAACATCGAAGCT
GGGAAAGATGATGGTTTGACTGATGCACAGCAACAGTTTTCAGTGAAAGAAACAAACTTT
TCAGAGGGAAATTTAAAATTGAAAATTGGCCTCCAGGCTAAGAGAACTAAAAAACCTCCA
AAGAACTTGGAGAACTATGTATGTCGACCTGCCATAAAAACAACTATTAAGCACCCAAGG
AAAGCACTTAAAAGTGGAAAGATGACGGATGAAAAGAATGAACACTGTCCTTCAAAACGA
GACCCTTCAAAGTTGTACAAGAAAGCAGATGATGTTGCAGCCATTGAATGCCAGTCTGAA
GAAGTCATCCGTCTTCATTCACAGGGAGAAAACAATCCTTTGTCTAAGAAGCTGTCTCCA
GTACACTCAGAAATGGCAGATTATATTAATGCAACGCCATCTACTCTTCTTGGTAGCCGG
GATCCTGATTTAAAGGACAGAGCATTACTTAATGGAGGAACTAGTGTAACAGAAAAGTTG
GCACAGCTGATTGCTACCTGTCCTCCTTCCAAGTCTTCCAAGACAAAACCGAAGAAGTTA
GGAACTGGCACTACAGCAGGATTGGTTAGCAAGGATTTGATCAGGAAAGCAGGTGTTGGC
TCTGTAGCTGGAATAATACATAAGGACTTAATAAAAAAGCCAACCATCAGCACAGCAGTT
GGATTGGTAACTAAAGATCCTGGGAAAAAGCCAGTGTTTAATGCAGCAGTAGGATTGGTC
AATAAGGACTCTGTGAAAAAACTGGGAACTGGCACTACAGCGGTATTCATTAATAAAAAC
TTAGGCAAAAAGCCAGGAACTATCACTACAGTAGGACTGCTAAGCAAAGATTCAGGAAAG
AAGCTAGGAATTGGTATTGTTCCAGGTTTAGTGCATAAAGAGTCTGGCAAGAAGTTAGGA
CTTGGCACTGTGGTTGGACTGGTTAATAAAGATTTGGGAAAGAAATTGGGTTCTACTGTT
GGCCTAGTGGCCAAGGACTGTGCAAAGAAGATTGTAGCAAGTTCAGCAATGGGATTGGTT
AATAAGGACATTGGAAAGAAACTAATGAGTTGTCCTTTGGCAGGTCTGATCAGTAAAGAT
GCCATAAACCTTAAAGCCGAAGCACTGCTCCCCACTCAGGAACCGCTTAAGGCTTCTTGT
AGTACAAACATCAATAATCAGGAAAGTCAGGAACTTTCTGAATCCCTGAAAGATAGTGCC
ACCAGCAAAACTTTTGAAAAGAATGTTGTACGGCAGAATAAAGAAAGCATATTGGAAAAG
TTCTCAGTACGAAAAGAAATCATTAATTTGGAGAAAGAAATGTTTAATGAAGGAACATGC
ATTCAGCAAGACAGTTTCTCATCCAGTGAAAAGGGATCTTATGAAACCTCAAAGCATGAA
AAGCAGCCTCCTGTATATTGCACTTCTCCGGACTTTAAAATGGGAGGTGCTTCTGATGTA
TCTACCGCTAAATCCCCATTCAGTGCAGTAGGAGAAAGCAATCTCCCTTCCCCATCACCT
ACTGTATCTGTTAATCCTTTAACCAGAAGTCCCCCTGAAACTTCTTCACAGTTGGCTCCT
AATCCATTACTTTTAAGTTCTACTACAGAACTAATCGAAGAAATTTCTGAATCTGTTGGA
AAGAACCAGTTTACTTCTGAAAGTACCCACTTGAACGTTGGTCATAGGTCAGTTGGTCAT
AGTATAAGTATTGAATGTAAAGGGATTGATAAAGAGGTAAATGATTCAAAAACTACCCAT
ATAGATATTCCAAGAATAAGCTCTTCCCTTGGAAAAAAGCCAAGTTTGACTTCTGAATCC
AGCATTCATACTATTACTCCTTCAGTTGTTAACTTCACTAGTTTATTTAGTAATAAGCCT
TTTTTAAAACTGGGTGCAGTATCTGCATCAGACAAACACTGCCAAGTTGCTGAAAGCCTA
AGTACTAGTTTGCAGTCCAAACCATTAAAAAAAAGAAAAGGAAGAAAACCTCGGTGGACT
AAAGTGGTGGCAAGAAGCACATGCCGGTCTCCAAAAGGGCTAGAATTAGAAAGATCAGAG
CTTTTTAAAAACGTTTCATGTAGCTCACTATCAAATAGTAATTCTGAGCCAGCCAAGTTT
ATGAAAAACATTGGACCCCCTTCATTTGTAGATCATGACTTCCTTAAACGCCGATTGCCA
AAGTTGAGCAAATCCACAGCTCCATCTCTTGCTCTCTTAGCTGATAGTGAAAAACCATCT
CATAAGTCTTTTGCTACTCACAAACTATCCTCCAGTATGTGTGTCTCTAGTGACCTTTTG
TCTGATATTTATAAGCCCAAAAGAGGAAGGCCTAAATCTAAGGAGATGCCTCAACTGGAA
GGGCCACCTAAAAGGACTTTAAAAATCCCTGCTTCTAAAGTGTTTTCTTTACAGTCTAAG
GAAGAACAAGAACCCCCAATTTTACAGCCAGAAATTGAAATCCCTTCCTTCAAACAAGGT
CTGTCTGTGTCTCCTTTTCCAAAAAAGAGAGGCAGGCCTAAGAGGCAAATGAGGTCACCA
GTCAAGATGAAGCCACCTGTACTGTCAGTGGCTCCATTTGTTGCCACTGAAAGTCCAAGC
AAGCTAGAATCTGAAAGTGACAACCATAGAAGTAGCAGTGATTTCTTTGAGAGCGAGGAT
CAACTTCAGGATCCAGATGACCTAGATGACAGTCATAGGCCAAGTGTCTGTAGTATGAGT
GACCTTGAGATGGAACCAGATAAAAAAATTACCAAGAGAAACAATGGACAATTAATGAAA
ACAATTATCCGCAAAATAAATAAAATGAAGACTTTAAAGAGAAAGAAACTGTTGAATCAG
ATTCTTTCAAGTTCTGTAGAATCAAGTAATAAAGGGAAAGTGCAATCCAAACTCCATAAT
ACGGTATCAAGTCTTGCTGCCACATTTGGCTCTAAATTGGGCCAACAGATAAATGTCAGC
AAGAAAGGAACCATTTATATAGGAAAGAGAAGAGGTCGCAAACCAAAAACTGTCTTAAAT
GGTATTCTTTCTGGTAGTCCTACTAGCCTTGCTGTTCTTGAGCAAACAGCTCAACAGGCA
GCTGGGTCAGCATTAGGACAGATTCTTCCCCCATTACTGCCTTCATCTGCTAGTAGTTCT
GAGATTCTTCCATCACCTATTTGCTCTCAGTCTTCTGGGACTAGTGGAGGTCAGAGCCCT
GTAAGTAGTGATGCAGGTTTTGTTGAACCCAGTTCAGTGCCATATTTGCATTTACACTCC
AGACAGGGCAGTATGATTCAGACTCTTGCAATGAAGAAGGCCTCAAAGGGGAGGAGGCGG
TTATCTCCTCCTACTTTGTTGCCAAATTCTCCTTCGCACTTGAGTGAACTCACATCTCTA
AAAGAAGCTACTCCTTCCCCAATCAGTGAGTCTCATAGTGATGAGACCATTCCCAGTGAT
AGTGGAATTGGAACAGATAATAACAGCACATCAGACAGGGCAGAGAAATTTTGTGGGCAA
AAAAAGAGGAGGCATTCTTTTGAGCATGTTTCTCTGATTCCCCCTGAAACCTCTACAGTG
CTAAGCAGTCTTAAAGAAAAACATAAACACAAATGTAAGCGCAGGAATCATGATTACCTC
AGCTATGACAAGATGAAAAGGCAGAAACGAAAACGGAAAAAGAAATATCCCCAGCTTCGA
AATAGACAGGATCCAGACTTTATTGCAGAGCTGGAGGAACTAATAAGTCGCCTAAGTGAA
ATTCGGATCACTCATCGAAGTCATCATTTTATCCCCCGAGATCTTCTGCCAACTATCTTT
CGAATCAACTTTAATAGTTTCTATACACATCCTTCTTTCCCCTTAGACCCTTTGCACTAC
ATTCGAAAACCTGACTTAAAAAAGAAAAGAGGGAGACCCCCTAAGATGAGGGAGGCAATG
GCTGAAATGCCTTTTATGCACAGCCTTAGTTTTCCTCTTTCTAGTACTGGATTCTATCCA
TCTTATGGTATGCCTTACTCTCCTTCACCCCTTACAGCTGCTCCCATAGGATTAGGTTAC
TATGGAAGGTATCCTCCCACTCTTTATCCACCTCCTCCATCTCCTTCTTTCACCACGCCA
CTTCCACCTCCTTCCTATATGCATGCTGGTCATTTACTTCTCAATCCTGCCAAATACCAT
AAGAAAAAGCATAAGCTACTTCGACAGGAGGCCTTTCTTACAACCAGCAGGACTCCCCTC
CTTTCCATGAGTACCTACCCCAGTGTTCCTCCTGAGATGGCCTATGGTTGGATGGTTGAG
CACAAACACAGGCACCGTCACAAACACAGAGAACACCGTTCTTCTGAACAACCCCAGGTT
TCTATGGACACTGGCTCTTCCCGATCTGTCCTGGAATCTTTGAAGCGCTATAGATTTGGA
AAGGATGCTGTTGGAGAGCGATATAAGCATAAGGAAAAGCACCGTTGTCACATGTCCTGC
CCTCATCTCTCTCCTTCAAAAAGCTTAATAAACAGAGAGGAACAGTGGGTCCACCGAGAG
CCTTCAGAATCTAGTCCATTGGCCTTGGGATTGCAGACACCTTTACAGATTGACTGTTCA
GAAAGTTCTCCAAGCTTATCCCTTGGAGGATTCACTCCCAACTCTGAGCCAGCCAGCAGT
GATGAACATACAAACCTTTTCACAAGTGCAATAGGCAGCTGCAGAGTTTCAAACCCTAAC
TCCAGTGGCCGGAAGAAATTAACTGACAGCCCTGGACTCTTTTCTGCACAGGACACTTCA
CTAAATCGGCTTCACAGAAAGGAGTCACTGCCTTCTAACGAAAGGGCAGTACAGACTTTG
GCAGGCTCCCAGCCAACCTCTGATAAACCCTCCCAGCGGCCATCAGAGAGCACAAATTGT
AGCCCTACCCGGAAAAGGTCTTCATCTGAGAGTACTTCTTCAACAGTAAACGGAGTTCCC
TCTCGAAGTCCAAGATTAGTTGCTTCTGGGGATGACTCTGTGGATAGTCTGCTGCAGCGG
ATGGTACAAAATGAGGACCAAGAGCCCATGGAGAAAAGTATTGATGCTGTGATTGCAACT
GCCTCTGCACCACCTTCTTCCAGTCCAGGCCGTAGCCACAGCAAGGACCGAACCCTGGGA
AAACCAGACAGCCTTTTAGTGCCTGCAGTCGCAAGTGACTCTTGCAATAATAGCATCTCA
CTCCTATCTGAAAAGTTGACAAGCAGCTGTTCCCCCCATCATATCAAGAGAAGTGTAGTG
GAAGCTATGCAACGCCAAGCTCGGAAAATGTGCAATTACGACAAAATCTTGGCCACAAAG
AAAAACCTAGACCATGTCAATAAAATCTTAAAAGCCAAAAAACTTCAAAGGCAGGCCAGG
ACAGGGAATAACTTTGTGAAACGTAGGCCAGGTCGACCTCGGAAATGTCCCCTTCAGGCT
GTCGTATCAATGCAAGCATTCCAGGCTGCTCAGTTTGTCAACCCAGAATTGAACAGAGAC
GAGGAAGGAGCAGCACTGCACCTCAGTCCTGACACAGTTACAGATGTAATTGAGGCTGTT
GTTCAGAGTGTAAATCTGAACCCAGAACATAAAAAGGGGTTGAAGAGAAAAGGTTGGCTA
TTGGAAGAACAGACCAGAAAAAAGCAGAAGCCATTACCAGAGGAAGAAGAGCAAGAGAAT
AATAAAAGCTTTAATGAAGCACCAGTTGAGATTCCCAGTCCTTCTGAAACCCCAGCTAAA
CCTTCTGAACCTGAAAGTACCTTGCAGCCTGTGCTTTCTCTCATCCCAAGGGAAAAGAAG
CCCCCACGTCCCCCAAAGAAGAAGTATCAGAAAGCAGGGCTGTATTCTGACGTTTACAAA
ACTACAGACCCAAAGAGTCGATTGATCCAATTAAAGAAAGAGAAGCTGGAGTATACTCCA
GGAGAGCATGAATATGGATTATTTCCAGCGCCCATTCATGTTGTGTTTTTTGTTTCAGGA
AAGTATCTAAGACAAAAGAGAATTGACTTCCAGCTTCCTTATGATATCCTTTGGCAGTGG
AAACACAATCAGCTATACAAAAAGCCAGATGTCCCACTATATAAGAAAATTCGTTCAAAT
GTCTACGTTGATGTCAAACCCCTTTCTGGTTACGAAGCTACCACCTGTAACTGTAAGAAG
CCAGATGATGACACCAGGAAGGGCTGTGTTGATGACTGCCTCAATAGAATGATCTTTGCT
GAGTGTTCCCCCAACACTTGCCCATGTGGCGAGCAATGCTGTAACCAGAGGATACAGAGG
CATGAATGGGTGCAATGTCTAGAACGATTTCGAGCTGAGGAAAAAGGTTGGGGAATCAGA
ACCAAAGAGCCCCTAAAAGCTGGGCAGTTCATCATTGAATACCTAGGGGAGGTCGTCAGT
GAACAGGAGTTCAGGAACAGGATGATTGAGCAGTATCATAATCACAGTGACCACTACTGC
CTGAACCTGGATAGTGGGATGGTGATTGACAGTTACCGCATGGGAAATGAGGCCCGATTC
ATCAACCATAGCTGTGACCCAAATTGTGAAATGCAGAAATGGTCTGTTAATGGAGTATAC
CGGATTGGACTCTATGCTCTTAAAGACATGCCAGCTGGGACTGAACTCACTTATGATTAT
AACTTTCATTCCTTCAATGTGGAAAAACAGCAACTTTGTAAGTGTGGCTTTGAGAAATGT
CGAGGAATCATCGGAGGCAAGAGTCAGCGTGTGAATGGACTCACCAGCAGCAAAAACAGC
CAGCCCATGGCCACACACAAAAAATCTGGACGGTCAAAAGAGAAGAGAAAGTCTAAGCAC
AAGCTGAAGAAAAGGAGAGGCCATCTCTCTGAGGAACCCAGTGAAAATATCAACACCCCA
ACTAGATTGACCCCCCAATTACAGATGAAGCCAATGTCCAATCGTGAAAGGAACTTTGTG
TTAAAGCATCATGTATTCTTGGTCCGAAACTGGGAGAAGATTCGTCAAAAACAGGAGGAA
GTAAAGCACACCAGTGATAATATTCACTCAGCATCATTATATACCCGTTGGAATGGGATC
TGCCGAGATGATGGGAATATCAAGTCTGATGTCTTCATGACCCAGTTCTCTGCCCTGCAG
ACAGCTCGATCTGTTCGAACAAGACGGTTGGCAGCTGCAGAGGAAAATATTGAAGTGGCT
CGGGCAGCCCGCCTAGCCCAGATCTTCAAAGAAATTTGTGATGGTATCATCTCTTATAAA
GATTCTTCCCGGCAAGCACTGGCAGCTCCACTTTTGAACCTTCCCCCAAAGAAAAAGAAT
GCTGATTATTATGAGAAGATCTCTGATCCCCTAGATCTTATCACCATAGAGAAGCAGATC
CTCACTGGTTACTATAAGACAGTGGAAGCTTTTGATGCTGACATGCTCAAAGTCTTTCGG
AATGCTGAGAAGTACTATGGGCGTAAATCCCCAGTTGGGAGAGATGTTTGTCGTCTACGA
AAGGCCTATTACAATGCCCGGCATGAGGCATCAGCCCAGATTGATGAGATTGTGGGAGAG
ACAGCAAGTGAGGCAGACAGCAGTGAGACCTCAGTCTCTGAAAAGGAGAATGGGCATGAG
AAGGACGACGATGTTATTCGCTGTATCTGTGGCCTCTACAACGATGAAGGTCTCATGATC
CAGTGTGACAAGTGCATGGTATGGCAGCACTGTGATTGTATGGGAGTGAACTCAGATGTG
GAGCACTACCTTTGTGAGCAGTGTGACCCAAGGCCTGTGGACAGGGAGGTTCCCATGATC
CCTCGGCCCCACTATGCCCAACCTGGCTGTGTCTACTTCATCTGTTTGCTCCGAGATGAC
TTGCTGCTTCGTCAGGGTGACTGTGTGTATCTGATGAGGGATAGTCGGCGCACCCCTGAT
GGCCACCCGGTCCGTCAGTCCTATCGACTGTTATCTCACATTAACCGACATAAACTTGAC
ATCTTTCGCATTGAGAAGCTTTGGAAGAATGAAAAAGAGGAACGGTTTGCCTTTGGTCAC
CATTATTTCCGTCCCCACGAAACACACCACTCTCCATCCCGTCGGTTCTATCATAATGAA
CTATTTCGGGTGCCACTCTATGAGATCATTCCCTTGGAGGCTGTAGTGGGGACCTGCTGT
GTGTTGGACCTTTATACGTATTGTAAAGGGAGACCCAAAGGAGTAAAGGAGCAAGATGTG
TACATCTGTGATTATCGGCTTGACAAGTCAGCACACCTGTTTTACAAGATCCACCGGAAC
CGCTATCCTGTCTGCACCAAACCCTATGCTTTTGATCACTTCCCCAAGAAGCTCACTCCC
AAAAAAGATTTCTCGCCTCATTACGTCCCAGACAACTACAAGAGGAATGGAGGACGATCA
TCCTGGAAGTCTGAGCGCTCAAAGCCACCCCTAAAAGACTTGGGCCAGGAGGATGATGCT
CTACCCTTGATTGAAGAGGTTCTAGCCAGTCAAGAGCAAGCAGCCAATGAGATACCCAGC
CTGGAGGAGCCAGAACGGGAAGGGGCCACTGCTAACGTCAGTGAGGGTGAAAAAAAAACA
GAGGAAAGTAGTCAAGAACCCCAGTCAACCTGTACCCCTGAGGAACGACGGCATAACCAA
CGGGAACGACTCAACCAGATCTTGCTCAATCTCCTTGAAAAAATCCCTGGAAAAAATGCC
ATTGATGTGACCTACTTGCTGGAGGAAGGATCAGGCAGGAAACTGCGAAGGCGTACTTTG
TTTATCCCAGAAAACAGCTTTCGAAAGTGA
Protein Properties
Number of Residues 2969
Molecular Weight 332207.495
Theoretical pI 9.392
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Probable histone-lysine N-methyltransferase ASH1L
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTLVSKREVELEKNTKEEEDLRKRNRERNIEA
GKDDGLTDAQQQFSVKETNFSEGNLKLKIGLQAKRTKKPPKNLENYVCRPAIKTTIKHPR
KALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIRLHSQGENNPLSKKLSP
VHSEMADYINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKL
GTGTTAGLVSKDLIRKAGVGSVAGIIHKDLIKKPTISTAVGLVTKDPGKKPVFNAAVGLV
NKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLMSCPLAGLISKD
AINLKAEALLPTQEPLKASCSTNINNQESQELSESLKDSATSKTFEKNVVRQNKESILEK
FSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSYETSKHEKQPPVYCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVG
KNQFTSESTHLNVGHRSVGHSISIECKGIDKEVNDSKTTHIDIPRISSSLGKKPSLTSES
SIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLP
KLSKSTAPSLALLADSEKPSHKSFATHKLSSSMCVSSDLLSDIYKPKRGRPKSKEMPQLE
GPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMS
DLEMEPDKKITKRNNGQLMKTIIRKINKMKTLKRKKLLNQILSSSVESSNKGKVQSKLHN
TVSSLAATFGSKLGQQINVSKKGTIYIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPYLHLHS
RQGSMIQTLAMKKASKGRRRLSPPTLLPNSPSHLSELTSLKEATPSPISESHSDETIPSD
SGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
SYDKMKRQKRKRKKKYPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIF
RINFNSFYTHPSFPLDPLHYIRKPDLKKKRGRPPKMREAMAEMPFMHSLSFPLSSTGFYP
SYGMPYSPSPLTAAPIGLGYYGRYPPTLYPPPPSPSFTTPLPPPSYMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMAYGWMVEHKHRHRHKHREHRSSEQPQV
SMDTGSSRSVLESLKRYRFGKDAVGERYKHKEKHRCHMSCPHLSPSKSLINREEQWVHRE
PSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAGSQPTSDKPSQRPSESTNC
SPTRKRSSSESTSSTVNGVPSRSPRLVASGDDSVDSLLQRMVQNEDQEPMEKSIDAVIAT
ASAPPSSSPGRSHSKDRTLGKPDSLLVPAVTSDSCNNSISLLSEKLTSSCSPHHIKRSVV
EAMQRQARKMCNYDKILATKKNLDHVNKILKAKKLQRQARTGNNFVKRRPGRPRKCPLQA
VVSMQAFQAAQFVNPELNRDEEGAALHLSPDTVTDVIEAVVQSVNLNPEHKKGLKRKGWL
LEEQTRKKQKPLPEEEEQENNKSFNEAPVEIPSPSETPAKPSEPESTLQPVLSLIPREKK
PPRPPKKKYQKAGLYSDVYKTTDPKSRLIQLKKEKLEYTPGEHEYGLFPAPIHVVFFVSG
KYLRQKRIDFQLPYDILWQWKHNQLYKKPDVPLYKKIRSNVYVDVKPLSGYEATTCNCKK
PDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIR
TKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARF
INHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKC
RGIIGGKSQRVNGLTSSKNSQPMATHKKSGRSKEKRKSKHKLKKRRGHLSEEPSENINTP
TRLTPQLQMKPMSNRERNFVLKHHVFLVRNWEKIRQKQEEVKHTSDNIHSASLYTRWNGI
CRDDGNIKSDVFMTQFSALQTARSVRTRRLAAAEENIEVARAARLAQIFKEICDGIISYK
DSSRQALAAPLLNLPPKKKNADYYEKISDPLDLITIEKQILTGYYKTVEAFDADMLKVFR
NAEKYYGRKSPVGRDVCRLRKAYYNARHEASAQIDEIVGETASEADSSETSVSEKENGHE
KDDDVIRCICGLYKDEGLMIQCDKCMVWQHCDCMGVNSDVEHYLCEQCDPRPVDREVPMI
PRPHYAQPGCVYFICLLRDDLLLRQGDCVYLMRDSRRTPDGHPVRQSYRLLSHINRDKLD
IFRIEKLWKNEKEERFAFGHHYFRPHETHHSPSRRFYHNELFRVPLYEIIPLEAVVGTCC
VLDLYTYCKGRPKGVKEQDVYICDYRLDKSAHLFYKIHRNRYPVCTKPYAFDHFPKKLTP
KKDFSPHYVPDNYKRNGGRSSWKSERSKPPLKDLGQEDDALPLIEEVLASQEQAANEIPS
LEEPEREGATANVSEGEKKTEESSQEPQSTCTPEERRHNQRERLNQILLNLLEKIPGKNA
IDVTYLLEEGSGRKLRRRTLFIPENSFRK
GenBank ID Protein 7739725
UniProtKB/Swiss-Prot ID Q9NR48
UniProtKB/Swiss-Prot Entry Name ASH1L_HUMAN
PDB IDs
GenBank Gene ID AF257305
GeneCard ID ASH1L
GenAtlas ID ASH1L
HGNC ID HGNC:19088
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  5. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  6. Vasilescu J, Zweitzig DR, Denis NJ, Smith JC, Ethier M, Haines DS, Figeys D: The proteomic reactor facilitates the analysis of affinity-purified proteins by mass spectrometry: application for identifying ubiquitinated proteins in human cells. J Proteome Res. 2007 Jan;6(1):298-305. [PubMed:17203973 ]
  7. Nagase T, Kikuno R, Ishikawa KI, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Feb 28;7(1):65-73. [PubMed:10718198 ]
  8. Nakamura T, Blechman J, Tada S, Rozovskaia T, Itoyama T, Bullrich F, Mazo A, Croce CM, Geiger B, Canaani E: huASH1 protein, a putative transcription factor encoded by a human homologue of the Drosophila ash1 gene, localizes to both nuclei and cell-cell tight junctions. Proc Natl Acad Sci U S A. 2000 Jun 20;97(13):7284-9. [PubMed:10860993 ]