You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09015
Secondary Accession Numbers
  • 14756
Name Leucine carboxyl methyltransferase 2
Synonyms
  1. p21WAF1/CIP1 promoter-interacting protein
  2. tRNA wybutosine-synthesizing protein 4 homolog
  3. tRNA yW-synthesizing protein 4 homolog
Gene Name LCMT2
Protein Type Unknown
Biological Properties
General Function Involved in methyltransferase activity
Specific Function Probable S-adenosyl-L-methionine-dependent methyltransferase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. May methylate the carboxyl group of leucine residues to form alpha- leucine ester residues
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
transferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 15q15.3
SNPs LCMT2
Gene Sequence
>2061 bp
ATGGGCCCCCGGAGCCGTGAGCGTCGGGCAGGCGCGGTACAGAACACCAACGACAGCAGC
GCCCTCAGCAAGCGTTCCCTGGCCGCGCGCGGGTACGTGCAGGACCCCTTTGCCGCGTTG
CTGGTTCCGGGCGCGGCGCGCCGCGCACCGCTCATTCACCGAGGCTACTACGTCCGCGCA
CGCGCCGTGAGGCACTGCGTGCGCGCTTTTTTGGAGCAGATTGGCGCGCCCCAGGCCGCG
CTTCGCGCGCAGATCTTGTCTCTCGGCGCTGGCTTCGACTCGCTCTATTTTCGCTTAAAA
ACCGCGGGCCGCCTGGCCCGGGCTGCAGTCTGGGAGGTGGATTTTCCGGACGTGGCGCGG
CGCAAAGCAGAAAGGATTGGAGAGACGCCAGAGCTGTGCGCGTTAACCGGGCCTTTCGAG
AGGGGGGAGCCCGCGTCCGCGCTGTGCTTTGAGAGCGCAGACTACTGCATCCTGGGTCTG
GACTTGCGGCAGCTCCAGCGAGTGGAGGAGGCCCTGGGCGCCGCGGGGCTCGACGCAGCC
TCACCCACTCTGCTCCTGGCCGAGGCGGTGCTGACCTACCTCGAGCCGGAGAGTGCCGCG
GCCCTCATCGCCTGGGCAGCCCAGCGTTTTCCTAATGCCCTTTTCGTGGTCTATGAGCAG
ATGAGGCCTCAAGACGCCTTTGGCCAGTTCATGCTGCAACATTTTCGGCAGCTAAACTCC
CCCCTGCATGGCCTGGAGCGTTTTCCTGACGTGGAGGCGCAGCGGCGCCGCTTCCTTCAA
GCTGGCTGGACCGCCTGCGGTGCCGTGGACATGAATGAATTCTATCACTGCTTTCTTCCC
GCAGAAGAACGCCGGCGGGTGGAAAATATTGAACCCTTTGACGAATTTGAGGAGTGGCAT
CTGAAGTGCGCCCATTATTTCATTCTGGCAGCTTCTAGGGGAGACACCCTCTCCCACACC
CTAGTGTTTCCATCCTCAGAGGCATTTCCTCGCGTAAATCCTGCTTCGCCTTCAGGGGTA
TTCCCTGCCAGCGTAGTCAGTAGCGAGGGCCAGGTCCCAAACCTGAAGAGATATGGCCAC
GCCTCTGTCTTCTTGAGCCCAGACGTTATTCTCAGTGCAGGAGGATTTGGAGAGCAGGAG
GGGCGGCACTGCCGAGTGAGCCAGTTTCACTTGCTCTCAAGAGATTGTGACTCTGAATGG
AAAGGCAGCCAAATAGGCAGTTGTGGGACTGGAGTTCAGTGGGATGGACGCCTTTATCAC
ACCATGACAAGACTCTCAGAGAGTCGGGTTCTGGTTCTGGGAGGGAGACTGTCCCCAGTA
AGTCCAGCCTTGGGGGTTCTCCAGCTTCATTTTTTTAAGAGTGAGGATAATAACACTGAG
GACCTGAAAGTGACAATAACAAAGGCTGGCCGAAAGGATGATTCCACTTTGTGTTGTTGG
CGGCATTCAACAACAGAAGTGTCCTGTCAGAATCAGGAATATTTGTTTGTGTATGGGGGT
CGAAGCGTGGTGGAACCTGTACTAAGTGACTGGCATTTCCTCCATGTAGGGACAATGGCT
TGGGTCAGGATCCCAGTGGAGGGAGAAGTACCTGAAGCCCGGCATTCTCACAGTGCCTGC
ACTTGGCAAGGGGGAGCCCTTATTGCTGGAGGTCTCGGGGCTTCTGAGGAGCCATTGAAC
TCTGTGCTCTTTCTGAGACCAATCTCTTGTGGATTCCTCTGGGAGTCAGTAGACATCCAG
CCTCCCATTACCCCAAGGTACTCCCACACAGCTCATGTGCTCAATGGAAAGCTGTTACTG
GTTGGAGGGATCTGGATTCATTCCTCCTCATTTCCTGGAGTGACTGTGATCAATTTGACT
ACAGGATTGAGCTCTGAGTATCAGATTGACACAACATATGTGCCATGGCCATTAATGTTA
CACAACCATACTAGTATCCTTCTTCCTGAAGAGCAACAGCTCCTGCTCCTTGGAGGTGGT
GGGAACTGCTTTTCCTTTGGTACCTACTTCAACCCCCATACAGTCACATTAGACCTTTCT
TCCTTAAGTGCTGGGCAGTAA
Protein Properties
Number of Residues 686
Molecular Weight 75601.1
Theoretical pI 6.71
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Leucine carboxyl methyltransferase 2
MGPRSRERRAGAVQNTNDSSALSKRSLAARGYVQDPFAALLVPGAARRAPLIHRGYYVRA
RAVRHCVRAFLEQIGAPQAALRAQILSLGAGFDSLYFRLKTAGRLARAAVWEVDFPDVAR
RKAERIGETPELCALTGPFERGEPASALCFESADYCILGLDLRQLQRVEEALGAAGLDAA
SPTLLLAEAVLTYLEPESAAALIAWAAQRFPNALFVVYEQMRPQDAFGQFMLQHFRQLNS
PLHGLERFPDVEAQRRRFLQAGWTACGAVDMNEFYHCFLPAEERRRVENIEPFDEFEEWH
LKCAHYFILAASRGDTLSHTLVFPSSEAFPRVNPASPSGVFPASVVSSEGQVPNLKRYGH
ASVFLSPDVILSAGGFGEQEGRHCRVSQFHLLSRDCDSEWKGSQIGSCGTGVQWDGRLYH
TMTRLSESRVLVLGGRLSPVSPALGVLQLHFFKSEDNNTEDLKVTITKAGRKDDSTLCCW
RHSTTEVSCQNQEYLFVYGGRSVVEPVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSAC
TWQGGALIAGGLGASEEPLNSVLFLRPISCGFLWESVDIQPPITPRYSHTAHVLNGKLLL
VGGIWIHSSSFPGVTVINLTTGLSSEYQIDTTYVPWPLMLHNHTSILLPEEQQLLLLGGG
GNCFSFGTYFNPHTVTLDLSSLSAGQ
GenBank ID Protein 25188199
UniProtKB/Swiss-Prot ID O60294
UniProtKB/Swiss-Prot Entry Name LCMT2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_014793.3
GeneCard ID LCMT2
GenAtlas ID LCMT2
HGNC ID HGNC:17558
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Nagase T, Ishikawa K, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1998 Feb 28;5(1):31-9. [PubMed:9628581 ]
  3. De Baere I, Derua R, Janssens V, Van Hoof C, Waelkens E, Merlevede W, Goris J: Purification of porcine brain protein phosphatase 2A leucine carboxyl methyltransferase and cloning of the human homologue. Biochemistry. 1999 Dec 14;38(50):16539-47. [PubMed:10600115 ]
  4. Ng CC, Arakawa H, Fukuda S, Kondoh H, Nakamura Y: p53RFP, a p53-inducible RING-finger protein, regulates the stability of p21WAF1. Oncogene. 2003 Jul 10;22(28):4449-58. [PubMed:12853982 ]