You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09016
Secondary Accession Numbers
  • 14757
Name mRNA cap guanine-N7 methyltransferase
Synonyms
  1. RG7MT1
  2. hCMT1
  3. hMet
  4. hcm1p
  5. mRNA (guanine-N(7)-)-methyltransferase
  6. mRNA cap methyltransferase
Gene Name RNMT
Protein Type Unknown
Biological Properties
General Function Involved in mRNA capping
Specific Function mRNA-capping methyltransferase that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs. Binds RNA containing 5'-terminal GpppC.
Pathways
  • mRNA surveillance pathway
Reactions
S-Adenosylmethionine + G(5')pppR-RNA → S-Adenosylhomocysteine + m(7)G(5')pppR-RNA details
GO Classification
Biological Process
transcription from RNA polymerase II promoter
viral reproduction
Cellular Component
nucleolus
nucleoplasm
mRNA cap binding complex
Molecular Function
RNA binding
mRNA (guanine-N7-)-methyltransferase activity
Process
rna metabolic process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
rna processing
mrna processing
mrna capping
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location 18
Locus 18p11.21
SNPs RNMT
Gene Sequence
>1431 bp
ATGGCAAATTCTGCAAAAGCAGAAGAATATGAAAAGATGTCTCTTGAACAGGCAAAAGCG
TCAGTGAATTCTGAAACAGAGTCTTCATTCAATATTAATGAAAACACAACAGCTTCTGGG
ACTGGGCTTTCTGAAAAGACTTCTGTCTGTAGGCAAGTAGACATAGCAAGAAAGAGAAAA
GAGTTTGAAGATGATCTTGTAAAGGAAAGTTCTAGTTGTGGGAAAGACACTCCATCCAAG
AAGAGAAAACTTGATCCTGAAATTGTCCCAGAGGAAAAAGATTGTGGTGATGCTGAAGGC
AATTCAAAGAAAAGAAAAAGAGAAACTGAGGATGTTCCAAAAGATAAATCTTCTACTGGA
GATGGCACTCAAAATAAGAGAAAAATAGCACTTGAGGATGTTCCTGAAAAGCAGAAAAAT
CTGGAAGAAGGACACAGCTCAACAGTGGCTGCCCATTACAATGAACTTCAGGAAGTTGGT
TTGGAGAAGCGTAGTCAAAGTCGTATTTTTTACCTAAGAAACTTTAATAATTGGATGAAA
AGTGTTCTCATTGGAGAATTTTTGGAAAAGGTACGACAGAAGAAAAAACGTGATATCACT
GTTTTGGACCTGGGATGTGGTAAAGGTGGAGATTTGCTGAAATGGAAAAAAGGAAGAATT
AACAAGCTAGTTTGTACTGATATTGCCGATGTTTCTGTCAAACAGTGTCAGCAGCGGTAT
GAGGACATGAAAAATCGTCGTGATAGTGAATATATTTTCAGTGCAGAATTTATAACTGCT
GACAGCTCAAAGGAACTTCTGATTGACAAATTTCGTGACCCACAAATGTGTTTTGACATC
TGCAGTTGTCAGTTTGTCTGTCATTACTCATTTGAGTCTTATGAGCAGGCTGACATGATG
CTGAGAAATGCGTGTGAGAGACTTAGCCCTGGGGGCTATTTTATTGGTACTACTCCCAAT
AGCTTTGAATTGATAAGACGCCTTGAAGCTTCAGAAACAGAATCATTTGGAAATGAAATA
TATACTGTGAAATTTCAGAAGAAAGGAGATTATCCTTTATTTGGCTGCAAATATGACTTC
AACTTGGAAGGTGTTGTGGATGTTCCTGAATTCTTGGTCTATTTTCCATTGCTAAATGAA
ATGGCAAAGAAGTACAATATGAAACTAGTCTACAAAAAAACATTTCTGGAATTCTACGAA
GAAAAGATTAAGAACAATGAAAATAAAATGCTCTTAAAACGAATGCAGGCCTTGGAGCCA
TATCCTGCAAATGAGAGTTCTAAACTTGTCTCTGAGAAGGTGGATGACTATGAACATGCA
GCAAAGTACATGAAGAACAGTCAAGTAAGGTTACCTTTGGGAACCTTAAGTAAATCAGAA
TGGGAAGCTACAAGTATTTACTTGGTGTTTGCCTTTGAGAAACAGCAGTGA
Protein Properties
Number of Residues 476
Molecular Weight 54843.655
Theoretical pI 6.614
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>mRNA cap guanine-N7 methyltransferase
MANSAKAEEYEKMSLEQAKASVNSETESSFNINENTTASGTGLSEKTSVCRQVDIARKRK
EFEDDLVKESSSCGKDTPSKKRKLDPEIVPEEKDCGDAEGNSKKRKRETEDVPKDKSSTG
DGTQNKRKIALEDVPEKQKNLEEGHSSTVAAHYNELQEVGLEKRSQSRIFYLRNFNNWMK
SVLIGEFLEKVRQKKKRDITVLDLGCGKGGDLLKWKKGRINKLVCTDIADVSVKQCQQRY
EDMKNRRDSEYIFSAEFITADSSKELLIDKFRDPQMCFDICSCQFVCHYSFESYEQADMM
LRNACERLSPGGYFIGTTPNSFELIRRLEASETESFGNEIYTVKFQKKGDYPLFGCKYDF
NLEGVVDVPEFLVYFPLLNEMAKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEP
YPANESSKLVSEKVDDYEHAAKYMKNSQVRLPLGTLSKSEWEATSIYLVFAFEKQQ
GenBank ID Protein 2662077
UniProtKB/Swiss-Prot ID O43148
UniProtKB/Swiss-Prot Entry Name MCES_HUMAN
PDB IDs
GenBank Gene ID AB007858
GeneCard ID RNMT
GenAtlas ID RNMT
HGNC ID HGNC:10075
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Ishikawa K, Nagase T, Nakajima D, Seki N, Ohira M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1997 Oct 31;4(5):307-13. [PubMed:9455477 ]
  3. Pillutla RC, Yue Z, Maldonado E, Shatkin AJ: Recombinant human mRNA cap methyltransferase binds capping enzyme/RNA polymerase IIo complexes. J Biol Chem. 1998 Aug 21;273(34):21443-6. [PubMed:9705270 ]
  4. Tsukamoto T, Shibagaki Y, Niikura Y, Mizumoto K: Cloning and characterization of three human cDNAs encoding mRNA (guanine-7-)-methyltransferase, an mRNA cap methylase. Biochem Biophys Res Commun. 1998 Oct 9;251(1):27-34. [PubMed:9790902 ]
  5. Yamada-Okabe T, Mio T, Kashima Y, Matsui M, Arisawa M, Yamada-Okabe H: The Candida albicans gene for mRNA 5-cap methyltransferase: identification of additional residues essential for catalysis. Microbiology. 1999 Nov;145 ( Pt 11):3023-33. [PubMed:10589710 ]
  6. Saha N, Schwer B, Shuman S: Characterization of human, Schizosaccharomyces pombe, and Candida albicans mRNA cap methyltransferases and complete replacement of the yeast capping apparatus by mammalian enzymes. J Biol Chem. 1999 Jun 4;274(23):16553-62. [PubMed:10347220 ]
  7. Wen Y, Shatkin AJ: Cap methyltransferase selective binding and methylation of GpppG-RNA are stimulated by importin-alpha. Genes Dev. 2000 Dec 1;14(23):2944-9. [PubMed:11114884 ]
  8. Shafer B, Chu C, Shatkin AJ: Human mRNA cap methyltransferase: alternative nuclear localization signal motifs ensure nuclear localization required for viability. Mol Cell Biol. 2005 Apr;25(7):2644-9. [PubMed:15767670 ]