Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09020
Secondary Accession Numbers
  • 14762
Name Histone-lysine N-methyltransferase MLL4
Synonyms
  1. KMT2D
  2. Lysine N-methyltransferase 2D
  3. Myeloid/lymphoid or mixed-lineage leukemia protein 4
  4. Trithorax homolog 2
  5. WBP-7
  6. WW domain-binding protein 7
  7. Lysine N-methyltransferase 2B
  8. KMT2B
Gene Name WBP7
Protein Type Unknown
Biological Properties
General Function Involved in DNA binding
Specific Function Histone methyltransferase. Methylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Plays a central role in beta-globin locus transcription regulation by being recruited by NFE2. Plays an important role in controlling bulk H3K4me during oocyte growth and preimplantation development. Required during the transcriptionally active period of oocyte growth for the establishment and/or maintenance of bulk H3K4 trimethylation (H3K4me3), global transcriptional silencing that preceeds resumption of meiosis, oocyte survival and normal zygotic genome activation.
Pathways
  • Lysine degradation
Reactions
S-Adenosylmethionine + L-lysine-[histone] → S-Adenosylhomocysteine + N(6)-methyl-L-lysine-[histone] details
Protein lysine + S-Adenosylmethionine → Protein N6-methyl-L-lysine + S-Adenosylhomocysteine details
S-Adenosylmethionine + Protein N6-methyl-L-lysine → S-Adenosylhomocysteine + Protein N6,N6-dimethyl-L-lysine details
S-Adenosylmethionine + Protein N6,N6-dimethyl-L-lysine → S-Adenosylhomocysteine + Protein N6,N6,N6-trimethyl-L-lysine details
GO Classification
Biological Process
ovulation
gene silencing
transcription, DNA-dependent
histone H3-K4 trimethylation
chromatin-mediated maintenance of transcription
oocyte differentiation
ovarian follicle development
regulation of histone H3-K4 methylation
Cellular Component
histone methyltransferase complex
Component
macromolecular complex
protein complex
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
methyltransferase complex
histone methyltransferase complex
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
zinc ion binding
transferase activity
protein binding
protein methyltransferase activity
protein-lysine n-methyltransferase activity
histone-lysine n-methyltransferase activity
nucleic acid binding
dna binding
histone methyltransferase activity (h3-k4 specific)
transferase activity, transferring one-carbon groups
methyltransferase activity
Molecular Function
metal ion binding
sequence-specific DNA binding transcription factor activity
zinc ion binding
DNA binding
histone methyltransferase activity (H3-K4 specific)
Process
cellular process
cellular component organization at cellular level
organelle organization
chromosome organization
chromatin organization
chromatin modification
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location 19
Locus 19q13.1
SNPs WBP7
Gene Sequence
>8148 bp
ATGGCGGCGGCGGCGGGCGGCGGCAGTTGCCCCGGGCCTGGCTCCGCGCGGGGCCGCTTC
CCGGGCCGGCCGCGGGGCGCCGGCGGGGGCGGGGGCCGCGGCGGACGGGGCAACGGGGCC
GAAAGAGTGCGGGTAGCTCTGCGGCGCGGCGGTGGCGCGACGGGGCCGGGCGGAGCCGAG
CCCGGGGAGGACACGGCCCTGCTCCGTTTGCTGGGGCTCCGCCGGGGCCTGCGCCGGCTC
CGCCGCCTGTGGGCCGGCCCGCGGGTCCAGCGGGGCCGGGGACGGGGTCGGGGCCGGGGC
TGGGGCCCGAGTCGAGGCTGCGTGCCGGAGGAGGAGAGCAGTGACGGGGAATCCGACGAG
GAGGAGTTTCAGGGTTTTCATTCAGATGAAGATGTGGCCCCCAGTTCCCTGCGCTCTGCG
CTCCGATCCCAGCGAGGTCGAGCGCCCCGAGGTCGGGGTCGCAAGCATAAGACGACCCCC
CTTCCTCCTCCTCGCCTAGCAGATGTGGCTCCTACCCCCCCAAAGACCCCTGCCCGGAAA
CGGGGTGAGGAAGGCACAGAACGGATGGTGCAGGCACTGACTGAACTTCTCCGGCGGGCC
CAGGCACCCCAAGCACCCCGGAGCCGGGCATGTGAGCCCTCCACCCCCCGGCGGTCTCGG
GGACGGCCCCCAGGACGGCCAGCAGGCCCCTGCAGGAGGAAGCAGCAAGCAGTAGTGGTG
GCAGAAGCAGCTGTGACAATCCCCAAACCTGAGCCCCCACCTCCTGTGGTTCCAGTGAAA
CATCAGACTGGCAGCTGGAAATGCAAGGAGGGGCCCGGTCCAGGACCTGGGACCCCCAGG
CGTGGAGGACAGTCAAGCCGTGGAGGCCGTGGAGGCAGGGGCCGCGGCCGAGGTGGTGGG
CTCCCCTTTGTGATCAAGTTTGTTTCAAGGGCCAAAAAAGTAAAGATGGGACAATTGTCC
TTGGGACTCGAATCAGGTCAAGGTCAAGGTCAACATGAGGAAAGTTGGCAGGATGTCCCC
CAAAGAAGAGTTGGATCTGGACAGGGAGGGAGCCCTTGCTGGAAAAAGCAGGAACAGAAG
CTGGATGACGAGGAAGAAGAGAAGAAAGAAGAAGAAGAAAAAGACAAGGAGGGAGAAGAG
AAGGAAGAAAGAGCTGTAGCTGAGGAGATGATGCCAGCTGCGGAAAAGGAAGAGGCAAAG
CTGCCACCACCGCCTCTGACTCCTCCAGCCCCTTCACCTCCTCCACCCCTCCCACCCCCT
TCGACATCTCCTCCACCCCCACTCTGCCCTCCACCACCACCCCCAGTGTCCCCACCACCT
CTACCATCCCCTCCACCGCCTCCTGCCCAAGAGGAGCAGGAGGAATCCCCTCCTCCTGTG
GTCCCAGCTACGTGCTCCAGGAAGAGGGGCCGGCCTCCCCTGACTCCCAGCCAGCGGGCG
GAGCGGGAAGCTGCTCGGGCAGGGCCAGAGGGCACCTCTCCTCCCACTCCAACCCCCAGC
ACCGCCACGGGAGGCCCTCCGGAAGACAGTCCCACCGTGGCCCCCAAAAGCACCACCTTC
CTGAAGAATATCCGGCAGTTTATTATGCCTGTGGTGAGTGCCCGCTCCTCCCGTGTCATC
AAGACACCCCGGCGATTTATGGATGAAGACCCCCCCAAACCCCCAAAGGTGGAGGTCTCA
CCTGTCCTGCGACCTCCCATTACCACCTCCCCACCTGTTCCCCAGGAGCCAGCACCAGTC
CCCTCTCCACCACGTGCCCCAACTCCTCCATCTACCCCAGTTCCACTCCCTGAGAAGAGA
CGGTCCATCCTAAGGGAACCCACATTTCGCTGGACCTCACTGACCCGGGAGCTGCCCCCT
CCTCCCCCAGCCCCTCCACCTCCCCCGGCCCCCTCCCCACCCCCTGCTCCTGCCACCTCC
TCCCGGAGGCCCCTACTCCTTCGGGCCCCTCAGTTTACCCCAAGCGAAGCCCACCTGAAG
ATCTACGAATCGGTGCTTACTCCTCCTCCTCTTGGGGCTCCTGAAGCCCCTGAGCCAGAG
CCTCCTCCTGCCGATGACTCTCCAGCTGAGCCTGAGCCTCGGGCAGTGGGCCGCACCAAC
CACCTCAGCCTGCCTCGATTCGCCCCTGTGGTCACCACTCCTGTTAAGGCCGAGGTGTCC
CCTCACGGGGCTCCAGCTCTGAGCAACGGGCCACAGACACAGGCTCAGCTACTGCAGCCC
CTGCAGGCCTTGCAAACCCAGCTCCTGCCCCAGGCACTACCGCCACCACAGCCACAGCTG
CAGCCACCGCCGTCACCACAGCAGATGCCTCCCCTGGAAAAAGCCCGGATTGCGGGCGTG
GGTTCCTTGCCGCTGTCTGGGGTAGAGGAGAAGATGTTCAGCCTCCTCAAGAGAGCCAAA
GTGCAGCTATTCAAGATCGATCAGCAGCAGCAGCAGAAGGTGGCAGCTTCCATGCCGCTG
AGCCCTGGAGGGCAGATGGAGGAGGTGGCCGGGGCTGTCAAGCAGATCTCCGACAGAGGC
CCTGTCCGGTCTGAAGATGAGTCGGTGGAAGCTAAGAGAGAGCGGCCCTCAGGTCCCGAG
TCCCCTGTGCAAGGTCCCCGCATCAAACATGTCTGCCGTCATGCTGCTGTGGCCCTGGGT
CAGGCCCGGGCCATGGTGCCTGAAGATGTCCCTCGCCTCAGTGCCCTCCCTCTCCGGGAT
CGGCAGGACCTCGCCACAGAGGATACATCATCGGCGTCCGAGACTGAGAGTGTCCCGTCA
CGGTCCCGGCGGGGAAAGGTGGAGGCAGCAGGCCCTGGGGGAGAATCAGAGCCCACAGGT
TCTGGAGGGACCCTGGCCCACACACCCCGGCGCTCACTGCCCTCCCATCACGGCAAGAAG
ATGCGCATGGCTCGATGTGGACACTGTCGGGGCTGCCTACGTGTGCAGGACTGTGGGTCC
TGTGTCAACTGCCTAGACAAGCCCAAGTTTGGGGGCCCTAACACCAAGAAGCAGTGCTGT
GTATACCGGAAGTGTGACAAAATAGAGGCTCGGAAGATGGAACGACTGGCTAAAAAAGGC
CGGACGATAGTGAAGACGCTGTTGCCCTGGGATTCCGATGAATCTCCTGAGGCCTCCCCT
GGTCCTCCAGGCCCACGCCGGGGGGCGGGAGCTGGGGGGCCCCGGGAGGAGGTGGTGGCC
CACCCAGGGCCCGAGGAGCAGGACTCCCTCCTGCAGCGCAAGTCAGCTCGGCGCTGCGTC
AAACAGCGACCCTCCTATGATATCTTCGAGGATTCGGATGACTCGGAGCCCGGGGGCCCC
CCTGCTCCTCGGCGTCGGACCCCCCGAGAAAATGAGCTGCCACTGCCAGAACCTGAGGAG
CAGAGCCGGCCCCGCAAACCTACCCTGCAGCCTGTGTTGCAGCTCAAGGCCCGAAGGCGC
CTGGACAAGGATGCTTTGGCCCCTGGCCCCTTTGCTTCTTTTCCCAATGGCTGGACTGGA
AAGCAGAAGTCTCCCGATGGTGTGCACCGCGTCCGTGTGGATTTTAAGGAGGATTGTGAT
TTAGAGAACGTGTGGCTGATGGGGGGCCTGAGTGTGCTCACCTCTGTGCCAGGGGGCCCC
CCGATGGTGTGCTTGCTGTGTGCCAGCAAAGGACTCCACGAGCTGGTGTTCTGTCAAGTC
TGCTGTGACCCATTCCACCCATTCTGCCTGGAGGAGGCCGAGCGGCCCCTGCCCCAGCAT
CACGACACCTGGTGCTGCCGTCGCTGCAAATTCTGCCACGTCTGTGGACGCAAAGGTCGT
GGATCCAAGCACCTCCTGGAGTGCGAGCGCTGCCGCCATGCATACCACCCGGCCTGTCTG
GGGCCCAGCTATCCAACCCGGGCCACGCGCAAACGGCGCCACTGGATCTGTTCAGCCTGT
GTGCGCTGTAAGAGCTGTGGGGCAACTCCAGGCAAGAACTGGGACGTCGAGTGGTCTGGA
GATTACAGCCTCTGCCCCAGGTGCACCCAGCTATATGAGAAAGGAAACTACTGCCCGATC
TGTACACGCTGCTATGAAGACAACGACTATGAGAGCAAGATGATGCAGTGCGCACAGTGC
GATCACTGGGTGCATGCCAAGTGCGAGGGGCTCTCAGATGAAGACTACGAGATCCTTTCA
GGACTGCCAGACTCGGTGCTGTACACCTGCGGACCGTGTGCTGGGGCAGCGCAGCCCCGC
TGGCGAGAGGCCCTGAGCGGGGCCCTCCAGGGGGGCCTGCGCCAGGTGCTCCAGGGCCTG
CTGAGCTCCAAGGTGGTGGGCCCACTGCTGCTCTGCACCCAGTGTGGGCCAGATGGGAAG
CAACTGCACCCAGGACCCTGCGGCCTGCAAGCTGTGAGTCAGCGCTTCGAGGATGGCCAC
TACAAGTCTGTGCACAGCTTCATGGAGGACATGGTGGGCATCCTCATGCGGCACTCGGAG
GAGGGAGAGACCCCGGACCGCCGGGCTGGAGGCCAGATGAAGGGGCTCCTGCTGAAGCTG
CTAGAATCTGCGTTCGGCTGGTTCGACGCCCACGACCCCAAGTACTGGCGACGGAGTACC
CGGCTGCCAAACGGAGTCCTTCCCAATGCGGTGTTGCCCCCATCCCTGGATCATGTCTAT
GCGCAGTGGAGACAGCAGGAACCAGAGACCCCAGAATCAGGGCAGCCTCCAGGGGATCCC
TCAGCAGCATTCCAGGGCAAGGATCCGGCTGCCTTCTCACACCTGGAGGACCCCCGTCAG
TGTGCACTCTGCCTCAAATACGGGGATGCAGACTCCAAGGAGGCGGGGCGGCTCTTGTAC
ATCGGGCAGAACGAGTGGACACACGTCAACTGTGCCATCTGGTCGGCGGAAGTCTTCGAG
GAGAACGACGGCTCCCTCAAGAATGTGCATGCTGCTGTGGCCCGAGGGAGGCAGATGCGC
TGCGAGCTCTGCCTGAAGCCTGGCGCCACGGTGGGCTGCTGCCTGTCCTCCTGCCTCAGC
AACTTCCACTTCATGTGTGCCCGGGCCAGCTACTGCATCTTCCAGGATGACAAGAAAGTC
TTCTGCCAGAAACACACTGATCTCCTGGATGGCAAGGAAATTGTGAACCCCGATGGTTTT
GATGTTCTCCGCCGAGTCTATGTGGACTTCGAGGGCATCAACTTCAAGCGGAAGTTCTTG
ACGGGGCTTGAACCCGATGCCATCAACGTGCTCATTGGTTCCATCCGCATTGACTCCCTG
GGTACTCTGTCTGATCTCTCGGACTGCGAGGGACGGCTCTTCCCCATTGGCTACCAGTGC
TCCCGTCTGTACTGGAGCACAGTGGATGCTCGGAGGCGCTGCTGGTATCGGTGCCGAATT
CTGGAGTATCGGCCATGGGGGCCGAGGGAAGAGCCAGCTCACCTGGAGGCTGCAGAGGAG
AACCAGACCATTGTGCACAGCCCCGCCCCTTCCTCAGAGCCCCCAGGTGGTGAGGACCCC
CCACTGGACACAGATGTTCTTGTCCCTGGAGCTCCTGAGCGCCACTCGCCCATTCAGAAC
CTGGACCCTCCACTGCGGCCAGATTCAGGCAGCGCCCCTCCTCCAGCCCCCCGTTCTTTT
TCGGGGGCTCGAATCAAAGTGCCCAACTACTCGCCATCCCGGAGGCCCTTGGGGGGTGTC
TCCTTTGGCCCCCTGCCCTCCCCTGGAAGTCCATCTTCACTGACCCACCACATCCCCACA
GTGGGAGACCCGGACTTCCCAGCTCCCCCCAGACGTTCCCGTCGTCCCAGCCCTTTGGCT
CCCAGGCCGCCTCCATCACGGTGGGCCTCCCCTCCTCTAAAAACCTCCCCTCAGCTCAGG
GTGCCCCCTCCTACCTCAGTCGTCACAGCCCTCACACCTACCTCAGGGGAGCTGGCTCCC
CCTGGCCCGGCCCCATCTCCACCACCCCCTGAAGACCTGGGCCCAGACTTCGAGGACATG
GAGGTGGTGTCAGGACTGAGTGCTGCTGACCTGGACTTCGCGGCCAGCCTGCTGGGGACT
GAGCCCTTCCAGGAAGAGATTGTAGCCGCTGGGGCCATGGGGAGCAGCCACGGGGGCCCG
GGGGACAGCTCCGAGGAGGAGTCCAGCCCCACCTCCCGCTACATCCACTTCCCTGTGACT
GTGGTGTCCGCCCCTGGTCTGGCCCCCAGCGCTACCCCTGGAGCCCCCCGCATTGAACAG
CTGGACGGCGTGGACGACGGCACTGACAGTGAGGCTGAGGCGGTGCAGCAGCCTCGGGGC
CAGGGCACGCCTCCTTCGGGGCCAGGAGTAGTCCGGGCAGGGGTCCTTGGGGCTGCAGGG
GACAGGGCCCGGCCTCCTGAGGACCTGCCATCGGAAATTGTGGATTTTGTGTTGAAGAAC
CTAGGGGGTCCTGGGGATGGAGGTGCTGGCCCTAGAGAGGAGTCACTCCCCCCGGCGCCT
CCCCTGGCTAATGGCAGCCAGCCCTCCCAAGGCCTGACCGCCAGCCCAGCTGACCCCACC
CGCACATTTGCCTGGCTCCCAGGGGCCCCAGGGGTCCGGGTGTTAAGCCTTGGCCCTGCC
CCTGAGCCCCCCAAACCCGCCACATCCAAAATCATACTTGTCAACAAGCTGGGGCAAGTA
TTTGTGAAGATGGCTGGGGAGGGTGAACCTGTCCCACCCCCAGTGAAGCAGCCACCTTTG
CCCCCCACCATTTCCCCCACGGCTCCCACCTCCTGGACTCTGCCCCCAGGCCCCCTCCTC
GGCGTGCTGCCCGTGGTCGGAGTGGTCCGCCCTGCCCCGCCCCCGCCACCCCCTCCCCTG
ACGCTGGTGCTGAGCAGTGGGCCAGCCAGCCCGCCCCGCCAGGCCATCCGCGTCAAGAGG
GTGTCCACTTTCTCCGGCCGGTCCCCGCCAGCACCTCCCCCATACAAAGCCCCCCGGCTG
GATGAAGATGGAGAGGCCTCAGAGGATACCCCTCAGGTTCCAGGGCTTGGCAGTGGCGGG
TTTAGCCGTGTGAGGATGAAAACCCCCACAGTGCGTGGGGTCCTTGACCTGGATCGGCCT
GGGGAGCCCGCTGGGGAAGAAAGTCCTGGGCCCCTCCAGGAACGGTCCCCTTTGCTGCCA
CTTCCGGAAGATGGTCCTCCCCAGGTCCCCGATGGTCCCCCAGACCTGCTGCTTGAGTCC
CAGTGGCACCACTATTCAGGTGAGGCTTCGAGCTCTGAGGAAGAGCCTCCATCCCCAGAT
GATAAAGAGAACCAGGCCCCAAAACGGACTGGCCCACATCTGCGCTTCGAGATCAGCAGT
GAGGATGGGTTCAGCGTTGAGGCAGAGAGCTTGGAGGGGGCGTGGAGAACTCTGATCGAG
AAAGTGCAAGAGGCCCGAGGGCATGCCCGACTCAGACATCTCTCCTTTAGTGGAATGAGT
GGGGCGAGACTCCTGGGCATCCACCATGATGCTGTCATCTTCCTGGCCGAGCAGCTCCCC
GGAGCCCAGCGTTGCCAGCACTATAAGTTCCGTTACCACCAGCAGGGAGAGGGCCAGGAG
GAGCCGCCCCTGAATCCCCATGGGGCTGCTCGGGCAGAGGTCTATCTCCGGAAGTGCACC
TTTGACATGTTCAACTTCCTGGCCTCCCAGCACCGGGTGCTCCCTGAGGGGGCCACCTGT
GATGAGGAAGAGGATGAGGTGCAGCTCAGGTCAACCAGACGTGCCACCAGCCTGGAGCTG
CCCATGGCCATGCGTTTTCGTCACCTTAAGAAGACGTCCAAAGAAGCTGTGGGTGTCTAC
AGATCAGCCATCCACGGGCGAGGCCTGTTCTGTAAGCGCAACATCGACGCGGGGGAGATG
GTCATCGAGTACTCTGGCATTGTCATCCGCTCGGTGTTGACTGACAAGCGGGAGAAGTTC
TACGATGGGAAGGGCATCGGGTGCTATATGTTCCGCATGGATGACTTTGATGTAGTGGAC
GCCACGATGCATGGCAATGCCGCCCGCTTCATCAACCACTCCTGTGAGCCCAACTGCTTC
TCTCGGGTCATCCACGTGGAGGGCCAGAAACACATTGTTATCTTCGCCCTGCGCCGCATC
CTGCGTGGTGAGGAGCTCACCTACGACTACAAGTTCCCCATCGAGGATGCCAGCAACAAG
CTGCCCTGCAACTGTGGCGCCAAGCGCTGCCGTCGGTTCCTTAACTGA
Protein Properties
Number of Residues 2715
Molecular Weight 293512.14
Theoretical pI 8.218
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Histone-lysine N-methyltransferase MLL4
MAAAAGGGSCPGPGSARGRFPGRPRGAGGGGGRGGRGNGAERVRVALRRGGGATGPGGAE
PGEDTALLRLLGLRRGLRRLRRLWAGPRVQRGRGRGRGRGWGPSRGCVPEEESSDGESDE
EEFQGFHSDEDVAPSSLRSALRSQRGRAPRGRGRKHKTTPLPPPRLADVAPTPPKTPARK
RGEEGTERMVQALTELLRRAQAPQAPRSRACEPSTPRRSRGRPPGRPAGPCRRKQQAVVV
AEAAVTIPKPEPPPPVVPVKHQTGSWKCKEGPGPGPGTPRRGGQSSRGGRGGRGRGRGGG
LPFVIKFVSRAKKVKMGQLSLGLESGQGQGQHEESWQDVPQRRVGSGQGGSPCWKKQEQK
LDDEEEEKKEEEEKDKEGEEKEERAVAEEMMPAAEKEEAKLPPPPLTPPAPSPPPPLPPP
STSPPPPLCPPPPPPVSPPPLPSPPPPPAQEEQEESPPPVVPATCSRKRGRPPLTPSQRA
EREAARAGPEGTSPPTPTPSTATGGPPEDSPTVAPKSTTFLKNIRQFIMPVVSARSSRVI
KTPRRFMDEDPPKPPKVEVSPVLRPPITTSPPVPQEPAPVPSPPRAPTPPSTPVPLPEKR
RSILREPTFRWTSLTRELPPPPPAPPPPPAPSPPPAPATSSRRPLLLRAPQFTPSEAHLK
IYESVLTPPPLGAPEAPEPEPPPADDSPAEPEPRAVGRTNHLSLPRFAPVVTTPVKAEVS
PHGAPALSNGPQTQAQLLQPLQALQTQLLPQALPPPQPQLQPPPSPQQMPPLEKARIAGV
GSLPLSGVEEKMFSLLKRAKVQLFKIDQQQQQKVAASMPLSPGGQMEEVAGAVKQISDRG
PVRSEDESVEAKRERPSGPESPVQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRD
RQDLATEDTSSASETESVPSRSRRGKVEAAGPGGESEPTGSGGTLAHTPRRSLPSHHGKK
MRMARCGHCRGCLRVQDCGSCVNCLDKPKFGGPNTKKQCCVYRKCDKIEARKMERLAKKG
RTIVKTLLPWDSDESPEASPGPPGPRRGAGAGGPREEVVAHPGPEEQDSLLQRKSARRCV
KQRPSYDIFEDSDDSEPGGPPAPRRRTPRENELPLPEPEEQSRPRKPTLQPVLQLKARRR
LDKDALAPGPFASFPNGWTGKQKSPDGVHRVRVDFKEDCDLENVWLMGGLSVLTSVPGGP
PMVCLLCASKGLHELVFCQVCCDPFHPFCLEEAERPLPQHHDTWCCRRCKFCHVCGRKGR
GSKHLLECERCRHAYHPACLGPSYPTRATRKRRHWICSACVRCKSCGATPGKNWDVEWSG
DYSLCPRCTQLYEKGNYCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDEDYEILS
GLPDSVLYTCGPCAGAAQPRWREALSGALQGGLRQVLQGLLSSKVVGPLLLCTQCGPDGK
QLHPGPCGLQAVSQRFEDGHYKSVHSFMEDMVGILMRHSEEGETPDRRAGGQMKGLLLKL
LESAFGWFDAHDPKYWRRSTRLPNGVLPNAVLPPSLDHVYAQWRQQEPETPESGQPPGDP
SAAFQGKDPAAFSHLEDPRQCALCLKYGDADSKEAGRLLYIGQNEWTHVNCAIWSAEVFE
ENDGSLKNVHAAVARGRQMRCELCLKPGATVGCCLSSCLSNFHFMCARASYCIFQDDKKV
FCQKHTDLLDGKEIVNPDGFDVLRRVYVDFEGINFKRKFLTGLEPDAINVLIGSIRIDSL
GTLSDLSDCEGRLFPIGYQCSRLYWSTVDARRRCWYRCRILEYRPWGPREEPAHLEAAEE
NQTIVHSPAPSSEPPGGEDPPLDTDVLVPGAPERHSPIQNLDPPLRPDSGSAPPPAPRSF
SGARIKVPNYSPSRRPLGGVSFGPLPSPGSPSSLTHHIPTVGDPDFPAPPRRSRRPSPLA
PRPPPSRWASPPLKTSPQLRVPPPTSVVTALTPTSGELAPPGPAPSPPPPEDLGPDFEDM
EVVSGLSAADLDFAASLLGTEPFQEEIVAAGAMGSSHGGPGDSSEEESSPTSRYIHFPVT
VVSAPGLAPSATPGAPRIEQLDGVDDGTDSEAEAVQQPRGQGTPPSGPGVVRAGVLGAAG
DRARPPEDLPSEIVDFVLKNLGGPGDGGAGPREESLPPAPPLANGSQPSQGLTASPADPT
RTFAWLPGAPGVRVLSLGPAPEPPKPATSKIILVNKLGQVFVKMAGEGEPVPPPVKQPPL
PPTISPTAPTSWTLPPGPLLGVLPVVGVVRPAPPPPPPPLTLVLSSGPASPPRQAIRVKR
VSTFSGRSPPAPPPYKAPRLDEDGEASEDTPQVPGLGSGGFSRVRMKTPTVRGVLDLDRP
GEPAGEESPGPLQERSPLLPLPEDGPPQVPDGPPDLLLESQWHHYSGEASSSEEEPPSPD
DKENQAPKRTGPHLRFEISSEDGFSVEAESLEGAWRTLIEKVQEARGHARLRHLSFSGMS
GARLLGIHHDAVIFLAEQLPGAQRCQHYKFRYHQQGEGQEEPPLNPHGAARAEVYLRKCT
FDMFNFLASQHRVLPEGATCDEEEDEVQLRSTRRATSLELPMAMRFRHLKKTSKEAVGVY
RSAIHGRGLFCKRNIDAGEMVIEYSGIVIRSVLTDKREKFYDGKGIGCYMFRMDDFDVVD
ATMHGNAARFINHSCEPNCFSRVIHVEGQKHIVIFALRRILRGEELTYDYKFPIEDASNK
LPCNCGAKRCRRFLN
GenBank ID Protein 7662046
UniProtKB/Swiss-Prot ID Q9UMN6
UniProtKB/Swiss-Prot Entry Name MLL4_HUMAN
PDB IDs
GenBank Gene ID NM_014727.1
GeneCard ID WBP7
GenAtlas ID Not Available
HGNC ID Not Available
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  8. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  9. Nagase T, Ishikawa K, Nakajima D, Ohira M, Seki N, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro. DNA Res. 1997 Apr 28;4(2):141-50. [PubMed:9205841 ]
  10. Cho YW, Hong T, Hong S, Guo H, Yu H, Kim D, Guszczynski T, Dressler GR, Copeland TD, Kalkum M, Ge K: PTIP associates with MLL3- and MLL4-containing histone H3 lysine 4 methyltransferase complex. J Biol Chem. 2007 Jul 13;282(28):20395-406. Epub 2007 May 11. [PubMed:17500065 ]
  11. Huntsman DG, Chin SF, Muleris M, Batley SJ, Collins VP, Wiedemann LM, Aparicio S, Caldas C: MLL2, the second human homolog of the Drosophila trithorax gene, maps to 19q13.1 and is amplified in solid tumor cell lines. Oncogene. 1999 Dec 23;18(56):7975-84. [PubMed:10637508 ]
  12. FitzGerald KT, Diaz MO: MLL2: A new mammalian member of the trx/MLL family of genes. Genomics. 1999 Jul 15;59(2):187-92. [PubMed:10409430 ]
  13. De Santa F, Totaro MG, Prosperini E, Notarbartolo S, Testa G, Natoli G: The histone H3 lysine-27 demethylase Jmjd3 links inflammation to inhibition of polycomb-mediated gene silencing. Cell. 2007 Sep 21;130(6):1083-94. Epub 2007 Sep 6. [PubMed:17825402 ]