Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09023
Secondary Accession Numbers
  • 14765
Name Histone-lysine N-methyltransferase NSD3
Synonyms
  1. Nuclear SET domain-containing protein 3
  2. Protein whistle
  3. WHSC1-like 1 isoform 9 with methyltransferase activity to lysine
  4. WHSC1-like protein 1
  5. Wolf-Hirschhorn syndrome candidate 1-like protein 1
Gene Name WHSC1L1
Protein Type Unknown
Biological Properties
General Function Involved in histone-lysine N-methyltransferase activity
Specific Function Histone methyltransferase. Preferentially methylates 'Lys-4' and 'Lys-27' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation, while 'Lys-27' is a mark for transcriptional repression.
Pathways
  • Lysine degradation
Reactions
S-Adenosylmethionine + L-lysine-[histone] → S-Adenosylhomocysteine + N(6)-methyl-L-lysine-[histone] details
Protein lysine + S-Adenosylmethionine → Protein N6-methyl-L-lysine + S-Adenosylhomocysteine details
S-Adenosylmethionine + Protein N6-methyl-L-lysine → S-Adenosylhomocysteine + Protein N6,N6-dimethyl-L-lysine details
S-Adenosylmethionine + Protein N6,N6-dimethyl-L-lysine → S-Adenosylhomocysteine + Protein N6,N6,N6-trimethyl-L-lysine details
GO Classification
Biological Process
cell growth
cell differentiation
regulation of transcription, DNA-dependent
transcription, DNA-dependent
Cellular Component
chromosome
nucleus
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
zinc ion binding
transferase activity
protein binding
protein methyltransferase activity
protein-lysine n-methyltransferase activity
histone-lysine n-methyltransferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
Molecular Function
histone-lysine N-methyltransferase activity
metal ion binding
zinc ion binding
Cellular Location
  1. Nucleus
  2. Chromosome
Gene Properties
Chromosome Location 8
Locus 8p11.2
SNPs WHSC1L1
Gene Sequence
>4314 bp
ATGGATTTCTCTTTCTCTTTCATGCAAGGGATCATGGGAAACACAATTCAGCAACCACCT
CAACTCATTGACTCCGCCAACATCCGTCAGGAGGATGCCTTTGATAACAACAGTGACATT
GCTGAAGATGGTGGCCAGACACCATATGAAGCTACTTTGCAGCAAGGCTTTCAGTACCCA
GCTACAACAGAAGATCTTCCTCCACTCACAAATGGGTATCCATCATCAATCAGTGTGTAT
GAAACTCAAACCAAATACCAGTCATATAATCAGTATCCTAATGGGTCAGCCAATGGCTTT
GGTGCAGTTAGAAACTTTAGCCCCACTGACTATTATCATTCAGAAATTCCAAACACAAGA
CCACATGAAATTCTGGAAAAACCTTCCCCTCCACAGCCACCACCTCCTCCTTCGGTACCA
CAAACTGTGATTCCAAAGAAGACTGGCTCACCTGAAATTAAACTAAAAATAACCAAAACT
ATCCAGAATGGCAGGGAATTGTTTGAGTCTTCCCTTTGTGGAGACCTTTTAAATGAAGTA
CAGGCAAGTGAGCACACGAAATCAAAGCATGAAAGCAGAAAAGAAAAGAGGAAAAAAAGC
AACAAGCATGACTCATCAAGATCTGAAGAGCGCAAGTCACACAAAATCCCCAAATTAGAA
CCAGAGGAACAAAATAGACCAAATGAGAGGGTTGACACTGTATCAGAAAAACCAAGGGAA
GAACCAGTACTAAAAGAGGAAGCCCCAGTTCAGCCAATACTATCTTCTGTTCCAACAACG
GAAGTGTCCACTGGTGTTAAGTTTCAGGTTGGCGATCTTGTGTGGTCCAAGGTGGGAACC
TATCCTTGGTGGCCTTGTATGGTTTCAAGTGATCCCCAGCTTGAGGTTCATACTAAAATT
AACACAAGAGGTGCCCGAGAATATCATGTCCAGTTTTTTAGCAACCAGCCAGAGAGGGCG
TGGGTTCATGAAAAACGGGTACGAGAGTATAAAGGTCATAAACAGTATGAAGAATTACTG
GCTGAGGCAACCAAACAAGCCAGCAATCACTCTGAGAAACAAAAGATTCGGAAACCCCGA
CCTCAGAGAGAACGTGCTCAGTGGGATATTGGCATTGCCCATGCAGAGAAAGCATTGAAA
ATGACTCGAGAAGAAAGAATAGAACAGTATACTTTTATTTACATTGATAAACAGCCTGAA
GAGGCTTTATCCCAAGCAAAAAAGAGTGTTGCCTCCAAAACCGAAGTTAAAAAAACCCGA
CGACCAAGATCTGTGCTGAATACTCAGCCAGAACAGACCAATGCAGGGGAGGTGGCCTCC
TCACTCTCAAGTACTGAAATTCGGAGACATAGCCAGAGGCGGCACACAAGTGCGGAAGAG
GAAGAGCCACCGCCTGTTAAAATAGCCTGGAAAACTGCGGCAGCAAGGAAATCCTTACCA
GCTTCCATTACGATGCACAAAGGGAGCCTGGATTTGCAGAAGTGTAACATGTCTCCAGTT
GTGAAAATTGAACAAGTGTTTGCTCTTCAGAATGCTACAGGGGATGGGAAATTTATCGAT
CAATTTGTTTATTCAACAAAGGGAATTGGTAACAAAACAGAAATAAGTGTCAGGGGGCAA
GACAGGCTTATAATTTCTACACCAAACCAGAGAAATGAAAAGCCAACGCAGAGTGTATCA
TCTCCTGAAGCAACATCTGGTTCTACAGGCTCAGTAGAAAAGAAGCAACAGAGAAGATCA
ATTAGAACTCGTTCTGAATCAGAGAAATCCACTGAGGTTGTGCCAAAGAAGAAGATCAAA
AAGGAGCAGGTTGAAACAGTTCCTCAGGCTACAGTGAAGACTGGATTACAGAAAGGTGCC
AGCGAGATTTCAGATTCCTGTAAACCTCTAAAGAAAAGGAGTCGCGCCTCAACTGATGTA
GAAATGACTAGTTCAGCATACAGAGACACATCTGACTCCGATTCTAGAGGACTGAGTGAC
CTGCAGGTAGGCTTTGGAAAGCAAGTAGATAGCCCTTCAGCTACTGCAGATGCAGACGTT
TCTGATGTGCAGTCCATGGATTCAAGTTTGTCGAGAAGAGGCACTGGAATGAGTAAGAAG
GACACTGTATGTCAGATTTGTGAAAGCTCTGGTGACTCTCTGATTCCTTGTGAGGGAGAG
TGCTGCAAACACTTTCACCTGGAGTGCCTGGGATTGGCATCACTTCCTGATAGCAAGTTC
ATCTGCATGGAATGTAAAACTGGGCAGCACCCATGTTTTTCGTGTAAAGTGTCTGGTAAA
GATGTGAAGCGTTGTTCTGTTGGTGCTTGTGGGAAATTTTATCATGAAGCCTGTGTCCGC
AAATTCCCCACTGCCATCTTTGAATCAAAAGGATTCCGCTGTCCTCAGCACTGCTGCTCT
GCCTGCTCTATGGAGAAAGATATCCACAAAGCAAGTAAAGGCCGCATGATGAGATGTTTA
AGATGTCCAGTTGCCTATCACTCTGGAGATGCTTGCATTGCGGCCGGAAGCATGTTAGTA
TCCTCCTACATTCTCATCTGTAGTAATCATTCCAAACGGAGCAGTAATTCTTCTGCTGTA
AATGTAGGCTTTTGTTTCGTTTGTGCCAGAGGGCTGATAGTTCAGGACCATTCAGACCCC
ATGTTCAGTTCATATGCCTATAAGTCCCACTACCTACTGAATGAATCAAATCGTGCTGAG
TTGATGAAATTACCTATGATTCCTTCTTCGTCAGCTTCCAAAAAGAAATGTGAGAAAGGT
GGAAGATTGCTCTGCTGTGAATCGTGCCCAGCTTCCTTCCACCCGGAATGCCTAAGCATA
GAAATGCCAGAAGGCTGCTGGAATTGTAATGACTGTAAAGCTGGCAAGAAACTACATTAC
AAGCAGATTGTTTGGGTCAAATTGGGAAATTACAGATGGTGGCCAGCAGAGATCTGCAAC
CCCAGGTCTGTGCCACTGAACATCCAGGGCCTTAAACATGACTTGGGGGACTTCCCTGTA
TTCTTCTTTGGTTCTCATGACTACTACTGGGTACACCAGGGCAGAGTGTTCCCTTATGTT
GAAGGAGACAAAAGCTTTGCTGAAGGGCAGACTAGTATTAACAAGACCTTCAAAAAGGCA
CTGGAAGAAGCTGCAAAACGTTTCCAGGAATTGAAAGCACAAAGAGAAAGTAAAGAAGCC
CTAGAGATTGAAAAAAACTCAAGAAAACCCCCTCCCTACAAACACATCAAAGCTAACAAA
GTAATAGGAAAGGTGCAGATCCAGGTTGCTGACCTGTCAGAGATTCCCCGCTGTAACTGC
AAGCCAGCTGATGAAAACCCTTGTGGCTTGGAATCGGAGTGCCTGAACAGAATGTTGCAG
TATGAATGCCACCCGCAGGTGTGCCCAGCTGGAGATCGTTGTCAGAACCAGTGCTTTACA
AAGAGACTATACCCTGATGCAGAGATCATCAAAACGGAGCGGAGAGGCTGGGGCCTCAGG
ACCAAAAGGAGCATTAAGAAGGGTGAATTTGTAAATGAATACGTCGGTGAATTAATTGAT
GAAGAAGAATGCAGATTGCGAATCAAGCGAGCCCACGAGAACAGTGTAACTAATTTTTAT
ATGTTAACTGTTACCAAGGACCGTATAATTGATGCCGGCCCAAAAGGAAATTATTCTCGC
TTCATGAACCACAGTTGTAATCCCAACTGTGAAACACAAAAGTGGACAGTGAATGGAGAT
GTTCGAGTGGGACTATTTGCTCTCTGTGATATTCCTGCAGGGATGGAGTTAACATTTAAT
TATAACCTAGATTGTCTGGGCAACGGCAGAACGGAGTGCCACTGTGGAGCAGATAACTGC
AGTGGTTTTCTAGGAGTGCGGCCAAAGTCGGCATGTGCGTCAACAAATGAAGAGAAGGCA
AAAAATGCTAAGTTAAAACAGAAGAGACGAAAGATCAAAACAGAACCAAAGCAGATGCAT
GAAGATTACTGTTTTCAATGTGGAGATGGTGGAGAGCTGGTCATGTGTGACAAAAAAGAC
TGTCCCAAAGCATACCACCTCCTATGCCTTAACCTGACTCAGCCACCATATGGAAAGTGG
GAGTGTCCGTGGCATCAGTGCGATGAGTGCAGCAGTGCAGCTGTTTCCTTCTGTGAATTC
TGTCCACATTCATTTTGTAAAGATCATGAAAAGGGGGCCCTGGTTCCCTCTGCACTGGAA
GGCCGCCTCTGCTGCTCGGAACATGACCCCATGGCTCCTGTGTCACCAGAATACTGGAGC
AAGATAAAATGTAAATGGGAATCACAAGATCATGGAGAAGAAGTAAAAGAATAA
Protein Properties
Number of Residues 1437
Molecular Weight 72620.72
Theoretical pI 9.072
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Histone-lysine N-methyltransferase NSD3
MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFDNNSDIAEDGGQTPYEATLQQGFQYP
ATTEDLPPLTNGYPSSISVYETQTKYQSYNQYPNGSANGFGAVRNFSPTDYYHSEIPNTR
PHEILEKPSPPQPPPPPSVPQTVIPKKTGSPEIKLKITKTIQNGRELFESSLCGDLLNEV
QASEHTKSKHESRKEKRKKSNKHDSSRSEERKSHKIPKLEPEEQNRPNERVDTVSEKPRE
EPVLKEEAPVQPILSSVPTTEVSTGVKFQVGDLVWSKVGTYPWWPCMVSSDPQLEVHTKI
NTRGAREYHVQFFSNQPERAWVHEKRVREYKGHKQYEELLAEATKQASNHSEKQKIRKPR
PQRERAQWDIGIAHAEKALKMTREERIEQYTFIYIDKQPEEALSQAKKSVASKTEVKKTR
RPRSVLNTQPEQTNAGEVASSLSSTEIRRHSQRRHTSAEEEEPPPVKIAWKTAAARKSLP
ASITMHKGSLDLQKCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIGNKTEISVRGQ
DRLIISTPNQRNEKPTQSVSSPEATSGSTGSVEKKQQRRSIRTRSESEKSTEVVPKKKIK
KEQVETVPQATVKTGLQKGASEISDSCKPLKKRSRASTDVEMTSSAYRDTSDSDSRGLSD
LQVGFGKQVDSPSATADADVSDVQSMDSSLSRRGTGMSKKDTVCQICESSGDSLIPCEGE
CCKHFHLECLGLASLPDSKFICMECKTGQHPCFSCKVSGKDVKRCSVGACGKFYHEACVR
KFPTAIFESKGFRCPQHCCSACSMEKDIHKASKGRMMRCLRCPVAYHSGDACIAAGSMLV
SSYILICSNHSKRSSNSSAVNVGFCFVCARGLIVQDHSDPMFSSYAYKSHYLLNESNRAE
LMKLPMIPSSSASKKKCEKGGRLLCCESCPASFHPECLSIEMPEGCWNCNDCKAGKKLHY
KQIVWVKLGNYRWWPAEICNPRSVPLNIQGLKHDLGDFPVFFFGSHDYYWVHQGRVFPYV
EGDKSFAEGQTSINKTFKKALEEAAKRFQELKAQRESKEALEIEKNSRKPPPYKHIKANK
VIGKVQIQVADLSEIPRCNCKPADENPCGLESECLNRMLQYECHPQVCPAGDRCQNQCFT
KRLYPDAEIIKTERRGWGLRTKRSIKKGEFVNEYVGELIDEEECRLRIKRAHENSVTNFY
MLTVTKDRIIDAGPKGNYSRFMNHSCNPNCETQKWTVNGDVRVGLFALCDIPAGMELTFN
YNLDCLGNGRTECHCGADNCSGFLGVRPKSACASTNEEKAKNAKLKQKRRKIKTEPKQMH
EDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQPPYGKWECPWHQCDECSSAAVSFCEF
CPHSFCKDHEKGALVPSALEGRLCCSEHDPMAPVSPEYWSKIKCKWESQDHGEEVKE
GenBank ID Protein 13699811
UniProtKB/Swiss-Prot ID Q9BZ95
UniProtKB/Swiss-Prot Entry Name NSD3_HUMAN
PDB IDs
GenBank Gene ID NM_023034.1
GeneCard ID WHSC1L1
GenAtlas ID WHSC1L1
HGNC ID HGNC:12767
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Stec I, van Ommen GJ, den Dunnen JT: WHSC1L1, on human chromosome 8p11.2, closely resembles WHSC1 and maps to a duplicated region shared with 4p16.3. Genomics. 2001 Aug;76(1-3):5-8. [PubMed:11549311 ]
  6. Angrand PO, Apiou F, Stewart AF, Dutrillaux B, Losson R, Chambon P: NSD3, a new SET domain-containing gene, maps to 8p12 and is amplified in human breast cancer cell lines. Genomics. 2001 May 15;74(1):79-88. [PubMed:11374904 ]
  7. Rosati R, La Starza R, Veronese A, Aventin A, Schwienbacher C, Vallespi T, Negrini M, Martelli MF, Mecucci C: NUP98 is fused to the NSD3 gene in acute myeloid leukemia associated with t(8;11)(p11.2;p15). Blood. 2002 May 15;99(10):3857-60. [PubMed:11986249 ]
  8. Tonon G, Wong KK, Maulik G, Brennan C, Feng B, Zhang Y, Khatry DB, Protopopov A, You MJ, Aguirre AJ, Martin ES, Yang Z, Ji H, Chin L, Depinho RA: High-resolution genomic profiles of human lung cancer. Proc Natl Acad Sci U S A. 2005 Jul 5;102(27):9625-30. Epub 2005 Jun 27. [PubMed:15983384 ]
  9. Kim SM, Kee HJ, Eom GH, Choe NW, Kim JY, Kim YS, Kim SK, Kook H, Kook H, Seo SB: Characterization of a novel WHSC1-associated SET domain protein with H3K4 and H3K27 methyltransferase activity. Biochem Biophys Res Commun. 2006 Jun 23;345(1):318-23. Epub 2006 Apr 27. [PubMed:16682010 ]