Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09028
Secondary Accession Numbers
  • 14770
Name Putative methyltransferase NSUN6
Synonyms
  1. NOL1/NOP2/Sun and PUA domain-containing protein 1
  2. NOL1/NOP2/Sun domain family member 6
Gene Name NSUN6
Protein Type Unknown
Biological Properties
General Function Involved in RNA binding
Specific Function May have S-adenosyl-L-methionine-dependent methyl- transferase activity (Potential)
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
nucleic acid binding
transferase activity, transferring one-carbon groups
methyltransferase activity
rna binding
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:1
Locus 10p12.31
SNPs NSUN6
Gene Sequence
>1410 bp
ATGTCTATTTTCCCTAAGATATCTTTGAGACCTGAGGTTGAAAACTATCTTAAGGAAGGC
TTTATGAATAAGGAGATTGTGACTGCTTTAGGTAAACAAGAAGCAGAAAGGAAGTTTGAA
ACTTTGTTAAAGCACCTGTCACATCCTCCATCATTTACAACTGTCAGAGTGAATACACAT
TTAGCCTCAGTACAACATGTGAAAAATCTGTTACTTGATGAACTTCAGAAGCAGTTTAAT
GGATTAAGTGTTCCTATTCTTCAACATCCAGACCTTCAAGATGTGTTACTTATTCCTGTT
ATTGGACCCAGAAAGAATATTAAAAAACAACAGTGTGAAGCCATTGTTGGAGCCCAGTGT
GGCAATGCAGTTTTAAGAGGAGCCCATGTCTATGCCCCAGGAATTGTGTCAGCATCACAA
TTTATGAAAGCTGGAGATGTTATTTCTGTATACTCTGATATTAAAGGAAAATGTAAGAAA
GGAGCCAAAGAATTTGATGGAACAAAAGTATTTCTTGGAAATGGGATTTCTGAACTAAGC
CGCAAAGAAATCTTCAGTGGATTACCTGAACTGAAAGGCATGGGCATAAGAATGACAGAA
CCAGTATATCTCAGCCCTTCATTTGACAGTGTACTGCCCCGTTACTTATTTTTACAAAAT
TTGCCATCTGCCTTAGTAAGTCATGTACTAAATCCTCAACCTGGAGAGAAGATTCTAGAC
TTGTGTGCAGCACCTGGAGGGAAAACAACACACATTGCAGCACTAATGCATGATCAGGGA
GAAGTTATAGCACTGGATAAAATCTTCAACAAAGTAGAAAAAATCAAACAGAATGCCTTA
TTGTTAGGGCTGAATTCCATCAGGGCATTTTGTTTTGATGGAACAAAGGCGGTTAAACTT
GATATGGTGGAGGACACAGAAGGAGAACCTCCATTTCTACCAGAATCCTTTGACCGAATT
CTTCTGGATGCACCCTGTAGTGGAATGGGACAGAGACCAAACATGGCCTGTACTTGGTCT
GTGAAGGAAGTGGCATCATATCAGCCATTACAGCGAAAACTCTTCACTGCAGCGGTTCAG
CTGCTGAAGCCAGAGGGTGTGCTGGTTTATAGCACGTGCACTATAACACTGGCCGAAAAT
GAAGAACAGGTTGCCTGGGCCCTGACAAAATTTCCTTGCCTTCAGCTTCAGCCCCAGGAA
CCGCAGATTGGAGGAGAAGGAATGAGGGGAGCTGGGCTCTCATGTGAACAGTTGAAACAG
CTGCAGCGATTTGATCCATCGGCTGTGCCATTACCGGACACTGACATGGACTCTCTTAGA
GAGGCCAGAAGAGAAGACATGTTGCGTCTGGCTAATAAGGACTCTATAGGTTTTTTTATT
GCAAAATTTGTAAAATGCAAAAGCACATAG
Protein Properties
Number of Residues 469
Molecular Weight 51769.8
Theoretical pI 8.05
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Putative methyltransferase NSUN6
MSIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPSFTTVRVNTH
LASVQHVKNLLLDELQKQFNGLSVPILQHPDLQDVLLIPVIGPRKNIKKQQCEAIVGAQC
GNAVLRGAHVYAPGIVSASQFMKAGDVISVYSDIKGKCKKGAKEFDGTKVFLGNGISELS
RKEIFSGLPELKGMGIRMTEPVYLSPSFDSVLPRYLFLQNLPSALVSHVLNPQPGEKILD
LCAAPGGKTTHIAALMHDQGEVIALDKIFNKVEKIKQNALLLGLNSIRAFCFDGTKAVKL
DMVEDTEGEPPFLPESFDRILLDAPCSGMGQRPNMACTWSVKEVASYQPLQRKLFTAAVQ
LLKPEGVLVYSTCTITLAENEEQVAWALTKFPCLQLQPQEPQIGGEGMRGAGLSCEQLKQ
LQRFDPSAVPLPDTDMDSLREARREDMLRLANKDSIGFFIAKFVKCKST
GenBank ID Protein 18676896
UniProtKB/Swiss-Prot ID Q8TEA1
UniProtKB/Swiss-Prot Entry Name NSUN6_HUMAN
PDB IDs Not Available
GenBank Gene ID AK074323
GeneCard ID NSUN6
GenAtlas ID NSUN6
HGNC ID HGNC:23529
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  5. Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ: Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer. Cell. 2007 Dec 14;131(6):1190-203. [PubMed:18083107 ]