You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09032
Secondary Accession Numbers
  • 14774
Name pre-rRNA processing protein FTSJ3
Synonyms
  1. Protein ftsJ homolog 3
  2. rRNA (uridine-2'-O-)-methyltransferase 3
  3. 2'-O-ribose RNA methyltransferase SPB1 homolog
  4. Putative rRNA methyltransferase 3
Gene Name FTSJ3
Protein Type Unknown
Biological Properties
General Function Involved in methyltransferase activity
Specific Function Probable methyltransferase involved in the processing of the 34S pre-rRNA to 18S rRNA and in 40S ribosomal subunit formation.
Pathways Not Available
Reactions
S-Adenosylmethionine + rRNA → S-Adenosylhomocysteine + rRNA containing 2'-O-methylnucleoside details
GO Classification
Biological Process
RNA methylation
rRNA processing
Cellular Component
nucleolus
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
Function
binding
catalytic activity
transferase activity
nucleic acid binding
transferase activity, transferring one-carbon groups
methyltransferase activity
Molecular Function
methyltransferase activity
Process
rna metabolic process
ncrna metabolic process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
cellular metabolic process
one-carbon metabolic process
rrna metabolic process
rrna processing
methylation
rrna modification
rrna methylation
Cellular Location
  1. Nucleus
  2. nucleolus
Gene Properties
Chromosome Location 17
Locus 17q23.3
SNPs FTSJ3
Gene Sequence
>2544 bp
ATGGGCAAGAAGGGCAAAGTTGGCAAGAGCCGACGAGACAAGTTTTATCACTTGGCGAAG
GAGACGGGTTACCGTTCCCGATCTGCTTTCAAGCTGATCCAGCTCAATCGCCGCTTTCAG
TTCCTGCAGAAAGCCCGAGCCTTGCTGGACCTGTGTGCTGCGCCAGGGGGATGGCTGCAG
GTAGCTGCCAAGTTTATGCCTGTATCCAGCCTTATTGTGGGAGTGGACCTGGTTCCAATC
AAGCCTCTCCCCAATGTGGTGACTCTCCAGCAGGACATCACAACAGAACGTTGTAGGCAG
GCCCTGAGGAAGGAGCTGAAGACCTGGAAGGTTGATGTTGTGCTCAATGATGGGGCCCCC
AACGTTGGGGCTAGCTGGGTCCATGATGCTTACTCACAAGCCCATTTGACACTGATGGCT
CTACGTTTGGCTTGTGACTTTTTGGCCCGTGGTGGCAGCTTCATCACAAAGGTTTTCCGT
TCTCGTGACTATCAGCCTCTGCTATGGATCTTTCAGCAGCTGTTCCGCCGTGTCCAGGCC
ACCAAGCCCCAAGCCTCTCGCCATGAATCTGCAGAGATCTTTGTAGTCTGCCAAGGATTC
CTGGCCCCTGACAAGGTTGACAGTAAATTCTTTGACCCCAAATTTGCCTTTAAGGAGGTT
GAAGTTCAGGCTAAGACCGTTACTGAATTGGTTACTAAGAAGAAGCCAAAGGCTGAAGGC
TATGCTGAGGGTGACCTCACTCTCTATCACCGTACCTCAGTCACTGACTTCCTCCGAGCT
GCCAACCCTGTTGACTTCCTCTCCAAGGCCAGCGAAATCATGGTAGATGATGAAGAGTTG
GCACAGCATCCAGCTACCACTGAGGACATACGGGTGTGCTGTCAGGACATCAGAGTGTTG
GGGCGCAAGGAGCTCAGGTCGCTACTAAACTGGAGAACAAAACTTCGGCGATATGTGGCC
AAGAAGCTGAAAGAACAAGCAAAGGCACTGGACATCAGCCTCAGCTCTGGAGAGGAAGAT
GAAGGTGATGAGGAGGACTCAACAGCTGGAACCACAAAGCAGCCCTCTAAGGAGGAGGAG
GAAGAGGAGGAGGAGGAACAACTGAACCAGACCTTGGCAGAAATGAAGGCCCAGGAGGTG
GCGGAATTGAAGAGGAAGAAAAAGAAGCTGTTGCGTGAGCAGAGAAAGCAGCGGGAGCGT
GTGGAGCTGAAGATGGATCTGCCTGGGGTTTCCATTGCAGACGAGGGGGAGACTGGCATG
TTCTCCTTGAGCACCATCCGGGGTCACCAGTTATTAGAGGAAGTAACACAAGGGGATATG
AGTGCAGCAGACACATTTCTGTCCGATCTGCCAAGGGATGATATCTATGTGTCAGATGTT
GAGGACGACGGTGATGACACATCTCTGGATAGTGACCTGGATCCAGAGGAGCTGGCAGGA
GTCAGGGGACATCAGGGTCTAAGGGACCAAAAGCGTATGCGACTTACTGAAGTGCAAGAT
GATAAAGAGGAGGAGGAGGAGGAGAATCCACTGCTGGTACCACTGGAGGAAAAGGCAGTA
CTGCAGGAAGAACAAGCCAACCTGTGGTTCTCAAAGGGCAGCTTTGCTGGGATCGAGGAC
GATGCCGATGAGGCCCTGGAGATCAGTCAGGCCCAGCTGTTATTTGAGAACCGGCGGAAG
GGACGGCAGCAGCAGCAGAAGCAGCAGCTGCCACAGACACCCCCTTCCTGTTTGAAGACT
GAGATAATGTCTCCCCTGTACCAAGATGAAGCCCCTAAGGGAACAGAGGCTTCTTCGGGG
ACAGAAGCTGCCACTGGCCTTGAAGGGGAAGAAAAGGATGGCATCTCAGACAGTGATAGC
AGTACTAGCAGTGAGGAAGAAGAGAGCTGGGAACCCCTCCGTGGTAAGAAGCGAAGCCGT
GGGCCTAAGTCAGATGATGACGGGTTTGAGATAGTGCCTATTGAGGACCCAGCGAAACAT
CGGATACTGGACCCCGAAGGCCTTGCTCTAGGTGCTGTTATTGCCTCTTCCAAAAAGGCC
AAGAGAGACCTCATAGATAACTCCTTCAACCGGTACACATTTAATGAGGATGAGGGGGAG
CTTCCGGAGTGGTTTGTGCAAGAGGAAAAGCAGCACCGGATACGACAGTTGCCTGTTGGT
AAGAAGGAGGTGGAGCATTACCGGAAACGCTGGCGGGAAATCAATGCACGTCCCATCAAG
AAGGTGGCTGAGGCTAAGGCTAGAAAGAAAAGGAGGATGCTGAAGAGGCTGGAGCAGACC
AGGAAGAAGGCAGAAGCCGTGGTGAACACAGTGGACATCTCAGAACGAGAGAAAGTGGCA
CAGCTGCGAAGTCTCTACAAGAAGGCTGGGCTTGGCAAGGAGAAACGCCATGTCACCTAC
GTTGTAGCCAAAAAAGGTGTGGGCCGCAAAGTGCGCCGGCCAGCTGGAGTCAGAGGTCAT
TTCAAGGTGGTGGACTCAAGGATGAAGAAGGACCAAAGAGCACAGCAACGTAAGGAACAA
AAGAAAAAACACAAACGGAAGTAA
Protein Properties
Number of Residues 847
Molecular Weight 96557.73
Theoretical pI 8.393
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Putative rRNA methyltransferase 3
MGKKGKVGKSRRDKFYHLAKETGYRSRSAFKLIQLNRRFQFLQKARALLDLCAAPGGWLQ
VAAKFMPVSSLIVGVDLVPIKPLPNVVTLQQDITTERCRQALRKELKTWKVDVVLNDGAP
NVGASWVHDAYSQAHLTLMALRLACDFLARGGSFITKVFRSRDYQPLLWIFQQLFRRVQA
TKPQASRHESAEIFVVCQGFLAPDKVDSKFFDPKFAFKEVEVQAKTVTELVTKKKPKAEG
YAEGDLTLYHRTSVTDFLRAANPVDFLSKASEIMVDDEELAQHPATTEDIRVCCQDIRVL
GRKELRSLLNWRTKLRRYVAKKLKEQAKALDISLSSGEEDEGDEEDSTAGTTKQPSKEEE
EEEEEEQLNQTLAEMKAQEVAELKRKKKKLLREQRKQRERVELKMDLPGVSIADEGETGM
FSLSTIRGHQLLEEVTQGDMSAADTFLSDLPRDDIYVSDVEDDGDDTSLDSDLDPEELAG
VRGHQGLRDQKRMRLTEVQDDKEEEEEENPLLVPLEEKAVLQEEQANLWFSKGSFAGIED
DADEALEISQAQLLFENRRKGRQQQQKQQLPQTPPSCLKTEIMSPLYQDEAPKGTEASSG
TEAATGLEGEEKDGISDSDSSTSSEEEESWEPLRGKKRSRGPKSDDDGFEIVPIEDPAKH
RILDPEGLALGAVIASSKKAKRDLIDNSFNRYTFNEDEGELPEWFVQEEKQHRIRQLPVG
KKEVEHYRKRWREINARPIKKVAEAKARKKRRMLKRLEQTRKKAEAVVNTVDISEREKVA
QLRSLYKKAGLGKEKRHVTYVVAKKGVGRKVRRPAGVRGHFKVVDSRMKKDQRAQQRKEQ
KKKHKRK
GenBank ID Protein 194097365
UniProtKB/Swiss-Prot ID Q8IY81
UniProtKB/Swiss-Prot Entry Name RRMJ3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_017647.3
GeneCard ID FTSJ3
GenAtlas ID FTSJ3
HGNC ID HGNC:17136
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  6. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  7. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  8. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  9. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  10. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  11. Zody MC, Garber M, Adams DJ, Sharpe T, Harrow J, Lupski JR, Nicholson C, Searle SM, Wilming L, Young SK, Abouelleil A, Allen NR, Bi W, Bloom T, Borowsky ML, Bugalter BE, Butler J, Chang JL, Chen CK, Cook A, Corum B, Cuomo CA, de Jong PJ, DeCaprio D, Dewar K, FitzGerald M, Gilbert J, Gibson R, Gnerre S, Goldstein S, Grafham DV, Grocock R, Hafez N, Hagopian DS, Hart E, Norman CH, Humphray S, Jaffe DB, Jones M, Kamal M, Khodiyar VK, LaButti K, Laird G, Lehoczky J, Liu X, Lokyitsang T, Loveland J, Lui A, Macdonald P, Major JE, Matthews L, Mauceli E, McCarroll SA, Mihalev AH, Mudge J, Nguyen C, Nicol R, O'Leary SB, Osoegawa K, Schwartz DC, Shaw-Smith C, Stankiewicz P, Steward C, Swarbreck D, Venkataraman V, Whittaker CA, Yang X, Zimmer AR, Bradley A, Hubbard T, Birren BW, Rogers J, Lander ES, Nusbaum C: DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Nature. 2006 Apr 20;440(7087):1045-9. [PubMed:16625196 ]
  12. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  13. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  14. Scherl A, Coute Y, Deon C, Calle A, Kindbeiter K, Sanchez JC, Greco A, Hochstrasser D, Diaz JJ: Functional proteomic analysis of human nucleolus. Mol Biol Cell. 2002 Nov;13(11):4100-9. [PubMed:12429849 ]
  15. Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R: Phosphoproteome analysis of the human mitotic spindle. Proc Natl Acad Sci U S A. 2006 Apr 4;103(14):5391-6. Epub 2006 Mar 24. [PubMed:16565220 ]