You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09035
Secondary Accession Numbers
  • 14777
Name Histone-lysine N-methyltransferase SETD2
Synonyms
  1. HIF-1
  2. HIP-1
  3. Huntingtin yeast partner B
  4. Huntingtin-interacting protein 1
  5. Huntingtin-interacting protein B
  6. Lysine N-methyltransferase 3A
  7. SET domain-containing protein 2
  8. hSET2
  9. p231HBP
Gene Name SETD2
Protein Type Unknown
Biological Properties
General Function Involved in histone-lysine N-methyltransferase activity
Specific Function Histone methyltransferase that methylates 'Lys-36' of histone H3. H3 'Lys-36' methylation represents a specific tag for epigenetic transcriptional activation. Probably plays a role in chromatin structure modulation during elongation via its interaction with hyperphosphorylated POLR2A. Binds DNA at promoters. May also act as a transcription activator that binds to promoters. Binds to the promoters of adenovirus 12 E1A gene in case of infection, possibly leading to regulate its expression.
Pathways
  • Lysine degradation
Reactions
S-Adenosylmethionine + L-lysine-[histone] → S-Adenosylhomocysteine + N(6)-methyl-L-lysine-[histone] details
Protein lysine + S-Adenosylmethionine → Protein N6-methyl-L-lysine + S-Adenosylhomocysteine details
S-Adenosylmethionine + Protein N6-methyl-L-lysine → S-Adenosylhomocysteine + Protein N6,N6-dimethyl-L-lysine details
S-Adenosylmethionine + Protein N6,N6-dimethyl-L-lysine → S-Adenosylhomocysteine + Protein N6,N6,N6-trimethyl-L-lysine details
GO Classification
Biological Process
angiogenesis
stem cell development
cell migration involved in vasculogenesis
coronary vasculature morphogenesis
embryonic cranial skeleton morphogenesis
embryonic placenta morphogenesis
histone H3-K36 methylation
mesoderm morphogenesis
morphogenesis of a branching structure
peptidyl-lysine trimethylation
pericardium development
neural tube closure
regulation of transcription, DNA-dependent
transcription, DNA-dependent
forebrain development
Cellular Component
chromosome
nucleus
Component
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
non-membrane-bounded organelle
intracellular non-membrane-bounded organelle
chromosome
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
transferase activity
protein binding
protein methyltransferase activity
protein-lysine n-methyltransferase activity
histone-lysine n-methyltransferase activity
oxidoreductase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
Molecular Function
histone-lysine N-methyltransferase activity
transition metal ion binding
oxidoreductase activity
DNA binding
Process
metabolic process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
oxidation reduction
Cellular Location
  1. Nucleus (Probable)
  2. Chromosome (Probable)
Gene Properties
Chromosome Location 3
Locus 3p21.31
SNPs SETD2
Gene Sequence
>7695 bp
ATGAAGCAGCTGCAGCCGCAGCCGCCTCCGAAGATGGGGGATTTCTACGACCCGGAGCAC
CCGACCCCTGAAGAAGAAGAAAATGAGGCAAAGATTGAAAATGTGCAGAAAACAGGTTTC
ATCAAAGGACCAATGTTCAAAGGTGTTGCTTCTAGTCGATTTTTGCCCAAAGGCACCAAA
ACAAAAGTTAATTTGGAAGAACAGGGACGACAGAAGGTGTCATTCAGCTTCAGCCTTACA
AAGAAAACTTTGCAGAATAGGTTTCTCACTGCACTTGGCAATGAAAAGCAAAGTGATACT
CCAAACCCTCCAGCTGTACCTCTTCAGGTAGACTCGACTCCTAAAATGAAAATGGAAATT
GGTGATACCTTATCTACTGCAGAAGAATCTTCCCCACCAAAGTCAAGGGTGGAATTGGGC
AAAATTCATTTTAAGAAACATCTGCTTCATGTAACATCCAGGCCACTGCTGGCTACTACC
ACAGCAGTAGCATCTCCACCTACTCATGCAGCACCATTACCAGCAGTGATAGCAGAATCA
ACAACTGTAGACTCACCGCCCTCATCTCCGCCTCCACCGCCTCCACCTGCCCAAGCCACA
ACACTCTCATCACCAGCACCAGTAACAGAGCCAGTGGCCTTGCCACATACACCAATAACA
GTTCTAATGGCAGCACCAGTACCCTTACCAGTAGATGTAGCAGTTAGATCTCTGAAAGAA
CCACCAATTATAATTGTACCAGAATCTTTAGAAGCAGATACTAAGCAGGACACTATATCT
AATAGTTTAGAAGAACACGTAACTCAAATATTGAATGAGCAAGCAGATATTTCCTCAAAA
AAAGAAGATTCCCATATTGGGAAGGATGAAGAAATTCCAGATAGTTCTAAGATTAGTCTG
AGCTGTAAAAAAACAGGTTCTAAGAAGAAATCCTCACAATCTGAAGGCATCTTTCTTGGT
TCAGAATCTGATGAAGATTCTGTACGGACTTCTTCAAGTCAAAGATCACATGATTTAAAA
TTTTCAGCAAGCATTGAAAAGGAAAGAGATTTTAAAAAGAGCTCAGCACCTTTAAAAAGT
GAGGATCTAGGGAAACCTTCACGATCTAAAACAGACAGAGATGATAAATATTTTAGCTAT
TCAAAACTTGAAAGAGATACTCGGTATGTATCTTCCCGATGTAGATCAGAAAGAGAGCGA
CGGCGGAGCAGATCTCACTCTAGGTCTGAGAGAGGCTCTAGAACTAATTTATCCTATTCC
AGGTCAGAACGATCTCATTATTATGACTCTGATCGTCGCTACCATAGGAGCTCCCCTTAT
CGAGAGAGGACGCGCTATTCTCGGCCATACACAGATAACAGAGCACGAGAGAGTTCTGAC
TCAGAAGAAGAGTATAAGAAGACATACTCAAGGCGTACCTCATCTCATTCCTCTTCTTAC
AGAGACCTAAGGACATCATCCTATTCTAAATCTGATCGGGACTGTAAAACTGAGACCTCT
TACTTAGAGATGGAAAGAAGAGGCAAGTATTCTTCAAAACTAGAAAGAGAATCTAAAAGG
ACTTCAGAAAATGAAGCAATTAAAAGATGTTGTTCTCCCCCTAATGAACTGGGATTCCGA
CGAGGGTCATCATATTCTAAGCATGACAGTAGTGCTTCCCGTTATAAATCTACCCTTTCA
AAACCTATACCCAAGTCTGATAAATTTAAAAATTCTTTCTGTTGTACAGAATTAAATGAA
GAAATCAAACAGTCTCATTCTTTTAGTTTACAGACACCTTGTTCAAAAGGTAGTGAATTA
AGAATGATTAATAAAAATCCTGAAAGAGAAAAGGCTGGGTCTCCAGCTCCATCAAATCGA
TTAAATGATTCACCTACTTTAAAAAAGCTAGATGAATTGCCTATTTTTAAGTCCGAATTT
ATAACACATGATAGCCATGATAGTATTAAGGAATTAGACTCTTTATCTAAAGTGAAGAAT
GATCAATTAAGAAGTTTTTGTCCCATAGAATTAAATATAAATGGATCTCCTGGGGCAGAA
TCTGATTTGGCAACATTTTGCACTTCTAAAACTGATGCTGTTTTAATGACTTCTGATGAT
AGTGTGACTGGATCGGAATTATCCCCTTTGGTCAAAGCATGCATGCTTTCATCAAATGGA
TTTCAGAATATTAGTAGGTGCAAAGAAAAAGACTTGGATGATACCTGCATGCTGCATAAG
AAGTCAGAAAGCCCATTTAGAGAAACAGAACCTCTGGTGTCACCACACCAAGATAAACTC
ATGTCTATGCCAGTTATGACTGTGGATTATTCCAAAACAGTAGTTAAAGAACCAGTTGAT
ACGAGGGTTTCTTGCTGCAAAACCAAAGATTCAGACATATACTGTACTTTGAACGATAGC
AACCCTTCTTTGTGTAACTCTGAAGCTGAAAATATTGAGCCTTCAGTTATGAAGATTTCT
TCAAATAGCTTTATGAATGTGCATTTGGAATCAAAACCAGTTATATGTGATAGTAGAAAT
TTGACAGATCACTCAAAATTTGCATGTGAAGAATATAAGCAGAGCATCGGTAGCACTAGT
TCAGCTTCTGTTAATCATTTTGATGATTTATATCAACCTATTGGGAGTTCAGGTATTGCT
TCATCTCTTCAGAGTCTTCCACCAGGAATAAAGGTGGACAGTCTAACTCTCTTGAAATGC
GGAGAGAACACATCTCCAGTTCTGGATGCAGTGCTAAAGAGTAAAAAAAGTTCAGAGTTT
TTAAAGCATGCAGGGAAAGAAACAATAGTAGAAGTAGGTAGTGACCTTCCTGATTCAGGA
AAGGGATTTGCTTCCAGGGAGAACAGGCGTAATAATGGGTTATCTGGGAAATGTTTGCAA
GAGGCTCAAGAAGAAGGGAATTCCATATTGCCTGAAAGAAGAGGAAGACCAGAAATCTCT
TTAGATGAAAGAGGAGAAGGAGGACATGTGCATACTTCTGATGACTCAGAAGTTGTATTT
TCTTCTTGTGATTTGAATTTAACCATGGAAGACAGTGATGGTGTAACTTATGCATTAAAG
TGTGACAGTAGTGGTCATGCCCCAGAAATTGTGTCTACAGTTCATGAAGATTATTCTGGC
TCTTCTGAAAGTTCAAATGATGAAAGTGATTCAGAAGATACAGATTCGGATGATAGCAGT
ATTCCAAGAAACCGTCTCCAGTCTGTTGTGGTTGTGCCAAAGAATTCTACTTTGCCCATG
GAAGAAACAAGTCCTTGTTCTTCTCGGAGCAGTCAAAGTTATAGACACTATTCTGACCAT
TGGGAAGATGAGAGATTGGAGTCAAGGAGACATTTGTATGAGGAAAAATTTGAAAGTATA
GCAAGTAAAGCCTGTCCTCAAACTGATAAGTTTTTCCTTCATAAAGGAACAGAGAAGAAT
CCGGAAATTTCTTTTACACAGTCCAGTAGAAAACAAATAGATAATCGCCTGCCTGAACTT
TCTCATCCTCAGAGTGATGGGGTTGATAGTACAAGTCATACAGATGTGAAATCTGACCCT
CTGGGTCACCCAAATTCAGAGGAAACCGTGAAAGCCAAAATACCTTCTAGGCAGCAAGAA
GAGCTGCCAATTTATTCTTCTGATTTTGAAGATGTCCCAAATAAGTCTTGGCAACAGACC
ACTTTCCAAAACAGGCCAGATAGTAGACTGGGAAAAACAGAATTGAGTTTTTCTTCCTCT
TGTGAGATACCACATGTGGATGGCTTGCACTCATCAGAAGAGCTCAGAAACTTAGGTTGG
GACTTCTCTCAAGAAAAGCCTTCTACCACGTATCAGCAACCTGACAGTAGCTATGGAGCT
TGTGGTGGACACAAGTATCAGCAAAATGCAGAACAGTATGGTGGGACACGTGATTACTGG
CAAGGCAATGGTTACTGGGATCCAAGATCAGGTAGACCTCCTGGAACTGGGGTTGTGTAT
GATCGAACTCAAGGACAAGTACCAGATTCCCTAACAGATGATCGTGAAGAAGAGGAGAAT
TGGGATCAACAGGATGGATCCCATTTTTCAGACCAGTCCGATAAATTTCTTCTATCCCTT
CAGAAAGACAAGGGGTCAGTGCAAGCACCTGAAATAAGCAGCAATTCCATTAAGGACACT
TTAGCTGTGAATGAAAAGAAAGATTTTTCAAAAAACTTAGAAAAAAATGATATCAAAGAT
AGAGGGCCTCTTAAAAAAAGGAGGCAGGAAATAGAGAGTGATTCTGAAAGTGATGGTGAG
CTTCAGGACAGAAAGAAAGTTAGAGTGGAGGTAGAGCAGGGAGAGACATCAGTGCCCCCA
GGTTCAGCACTGGTTGGGCCCTCCTGTGTCATGGATGACTTCAGGGACCCACAGCGATGG
AAGGAATGTGCCAAGCAAGGGAAAATGCCATGTTACTTTGATCTTATTGAAGAAAATGTT
TATTTAACAGAAAGAAAGAAGAATAAATCTCATCGAGATATTAAGCGAATGCAGTGTGAG
TGTACACCTCTTTCTAAAGATGAAAGAGCTCAAGGTGAAATAGCATGTGGGGAAGATTGT
CTTAATCGTCTTCTCATGATTGAATGTTCTTCTCGGTGTCCAAATGGGGATTATTGTTCC
AATAGACGGTTTCAGAGAAAACAGCATGCAGATGTGGAAGTCATACTCACAGAAAAGAAA
GGCTGGGGCTTGAGAGCTGCCAAAGACCTTCCTTCGAACACCTTTGTCCTAGAATATTGT
GGAGAGGTACTCGATCATAAAGAGTTTAAAGCTCGAGTGAAGGAGTATGCACGAAACAAA
AACATCCATTACTATTTCATGGCCCTGAAGAATGATGAGATAATAGATGCCACTCAAAAA
GGAAATTGCTCTCGTTTCATGAATCACAGCTGTGAACCAAATTGTGAAACCCAAAAATGG
ACTGTGAACGGACAACTGAGGGTTGGGTTTTTTACCACCAAACTGGTTCCTTCAGGCTCA
GAGTTAACGTTTGACTATCAGTTCCAGAGATATGGAAAAGAAGCCCAGAAATGTTTCTGC
GGATCAGCCAATTGCCGGGGTTACCTGGGAGGAGAAAACAGAGTCAGCATCAGAGCAGCA
GGAGGGAAAATGAAGAAGGAACGATCTCGTAAGAAGGATTCAGTGGATGGAGAGCTAGAA
GCTCTGATGGAAAATGGTGAGGGTCTCTCTGATAAAAACCAGGTGCTCAGCTTATCCCGG
CTAATGGTTAGAATTGAAACTTTGGAGCAGAAACTTACCTGTCTGGAACTCATACAGAAC
ACACACTCACAGTCCTGCCTGAAGTCCTTTCTGGAACGTCATGGGCTGTCTTTGTTGTGG
ATCTGGATGGCAGAGCTAGGTGACGGCCGGGAAAGTAACCAGAAGCTTCAGGAAGAGATT
ATAAAGACTTTGGAACACTTGCCCATTCCTACTAAAAATATGTTGGAGGAAAGCAAAGTA
CTTCCAATTATTCAACGCTGGTCTCAGACTAAGACTGCTGTCCCTCCGTTGAGTGAAGGA
GATGGGTATTCTAGTGAGAATACATCGCGTGCTCATACACCACTCAACACACCTGATCCT
TCCACCAAGCTGAGCACAGAAGCTGACACAGACACTCCCAAGAAACTAATGTTTCGCAGA
CTGAAAATTATAAGTGAAAATAGCATGGACAGTGCAATCTCTGATGCAACCAGTGAGCTA
GAAGGCAAGGATGGCAAAGAGGATCTTGATCAATTAGAAAATGTCCCTGTAGAGGAAGAG
GAAGAATTGCAGTCACAACAGCTACTCCCACAACAGCTGCCTGAATGCAAAGTTGATAGT
GAAACCAACATAGAAGCTAGTAAGCTACCTACATCTGAACCAGAAGCTGACGCTGAAATA
GAGCCCAAAGAGAGCAACGGCACAAAACTAGAAGAACCTATTAATGAAGAAACACCATCC
CAAGATGAAGAGGAGGGTGTGTCTGATGTGGAGAGTGAAAGGAGCCAAGAACAGCCAGAT
AAAACAGTGGATATAAGTGATTTGGCCACCAAACTCCTGGACAGTTGGAAAGACCTAAAG
GAGGTATATCGAATTCCAAAGAAAAGTCAAACTGAAAAGGAAAACACAACAACTGAACGA
GGAAGGGATGCTGTTGGCTTCAGAGATCAAACACCTGCCCCGAAGACTCCTAATAGGTCA
AGAGAGAGAGACCCAGACAAGCAAACTCAAAATAAAGAGAAAAGGAAACGAAGAAGCTCC
CTCTCACCACCCTCTTCTGCCTATGAGCGGGGAACAAAAAGGCCAGATGACAGATATGAT
ACACCAACTTCTAAAAAGAAAGTACGAATTAAAGACCGCAATAAACTTTCTACAGAGGAA
CGCCGGAAGTTGTTTGAGCAAGAGGTGGCTCAACGGGAGGCTCAGAAACAACAGCAACAG
ATGCAGAACCTGGGAATGACATCACCACTGCCCTATGACTCTCTTGGTTATAATGCCCCG
CATCATCCCTTTGCTGGTTACCCACCAGGTTATCCCATGCAGGCCTATGTGGATCCCAGC
AACCCTAATGCTGGAAAGGTGCTCCTGCCCACACCCAGCATGGACCCAGTGTGTTCTCCT
GCTCCTTATGATCATGCTCAGCCCTTGGTGGGACATTCTACAGAACCCCTTTCTGCCCCT
CCACCAGTACCAGTGGTGCCACATGTGGCAGCTCCTGTGGAAGTTTCCAGTTCCCAGTAT
GTGGCCCAGAGTGATGGTGTAGTACACCAAGACTCCAGCGTTGCTGTCTTGCCAGTGCCG
GCCCCCGGCCCAGTTCAGGGACAGAATTATAGTGTTTGGGATTCAAACCAACAGTCTGTC
AGTGTACAGCAGCAGTACTCTCCTGCACAGTCTCAAGCAACCATATATTATCAAGGACAG
ACATGTCCAACAGTCTATGGTGTGACATCACCTTATTCACAGACAACTCCACCAATTGTA
CAGAGTTATGCCCAGCCAAGTCTTCAGTATATCCAGGGGCAACAGATTTTCACAGCTCAT
CCACAAGGAGTGGTGGTACAGCCAGCCGCAGCAGTGACTACAATAGTTGCACCAGGGCAG
CCTCAGCCCTTGCAGCCATCTGAAATGGTTGTGACAAATAATCTCTTGGATCTGCCGCCC
CCCTCTCCTCCCAAACCAAAAACCATTGTCTTACCTCCCAACTGGAAGACAGCTCGAGAT
CCAGAAGGGAAGATTTATTACTACCATGTGATCACAAGGCAGACTCAGTGGGATCCTCCT
ACTTGGGAAAGCCCAGGAGATGATGCCAGCCTTGAGCATGAAGCTGAGATGGACCTGGGA
ACTCCAACATATGATGAAAACCCCATGAAGGCCTCGAAAAAGCCCAAGACAGCAGAAGCA
GACACCTCCAGTGAACTAGCAAAGAAAAGCAAAGAAGTATTCAGAAAAGAGATGTCCCAG
TTCATCGTCCAGTGCCTGAACCCTTACCGGAAACCTGACTGCAAAGTGGGAAGAATTACC
ACAACTGAAGACTTTAAACATCTGGCTCGCAAGCTGACTCACGGTGTTATGAATAAGGAG
CTGAAGTACTGTAAGAATCCTGAGGACCTGGAGTGCAATGAGAATGTGAAACACAAAACC
AAGGAGTACATTAAGAAGTACATGCAGAAGTTTGGGGCTGTTTACAAACCCAAAGAGGAC
ACTGAATTAGAGTGA
Protein Properties
Number of Residues 2564
Molecular Weight 287594.195
Theoretical pI 6.137
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Histone-lysine N-methyltransferase SETD2
MKQLQPQPPPKMGDFYDPEHPTPEEEENEAKIENVQKTGFIKGPMFKGVASSRFLPKGTK
TKVNLEEQGRQKVSFSFSLTKKTLQNRFLTALGNEKQSDTPNPPAVPLQVDSTPKMKMEI
GDTLSTAEESSPPKSRVELGKIHFKKHLLHVTSRPLLATTTAVASPPTHAAPLPAVIAES
TTVDSPPSSPPPPPPPAQATTLSSPAPVTEPVALPHTPITVLMAAPVPLPVDVAVRSLKE
PPIIIVPESLEADTKQDTISNSLEEHVTQILNEQADISSKKEDSHIGKDEEIPDSSKISL
SCKKTGSKKKSSQSEGIFLGSESDEDSVRTSSSQRSHDLKFSASIEKERDFKKSSAPLKS
EDLGKPSRSKTDRDDKYFSYSKLERDTRYVSSRCRSERERRRSRSHSRSERGSRTNLSYS
RSERSHYYDSDRRYHRSSPYRERTRYSRPYTDNRARESSDSEEEYKKTYSRRTSSHSSSY
RDLRTSSYSKSDRDCKTETSYLEMERRGKYSSKLERESKRTSENEAIKRCCSPPNELGFR
RGSSYSKHDSSASRYKSTLSKPIPKSDKFKNSFCCTELNEEIKQSHSFSLQTPCSKGSEL
RMINKNPEREKAGSPAPSNRLNDSPTLKKLDELPIFKSEFITHDSHDSIKELDSLSKVKN
DQLRSFCPIELNINGSPGAESDLATFCTSKTDAVLMTSDDSVTGSELSPLVKACMLSSNG
FQNISRCKEKDLDDTCMLHKKSESPFRETEPLVSPHQDKLMSMPVMTVDYSKTVVKEPVD
TRVSCCKTKDSDIYCTLNDSNPSLCNSEAENIEPSVMKISSNSFMNVHLESKPVICDSRN
LTDHSKFACEEYKQSIGSTSSASVNHFDDLYQPIGSSGIASSLQSLPPGIKVDSLTLLKC
GENTSPVLDAVLKSKKSSEFLKHAGKETIVEVGSDLPDSGKGFASRENRRNNGLSGKCLQ
EAQEEGNSILPERRGRPEISLDERGEGGHVHTSDDSEVVFSSCDLNLTMEDSDGVTYALK
CDSSGHAPEIVSTVHEDYSGSSESSNDESDSEDTDSDDSSIPRNRLQSVVVVPKNSTLPM
EETSPCSSRSSQSYRHYSDHWEDERLESRRHLYEEKFESIASKACPQTDKFFLHKGTEKN
PEISFTQSSRKQIDNRLPELSHPQSDGVDSTSHTDVKSDPLGHPNSEETVKAKIPSRQQE
ELPIYSSDFEDVPNKSWQQTTFQNRPDSRLGKTELSFSSSCEIPHVDGLHSSEELRNLGW
DFSQEKPSTTYQQPDSSYGACGGHKYQQNAEQYGGTRDYWQGNGYWDPRSGRPPGTGVVY
DRTQGQVPDSLTDDREEEENWDQQDGSHFSDQSDKFLLSLQKDKGSVQAPEISSNSIKDT
LAVNEKKDFSKNLEKNDIKDRGPLKKRRQEIESDSESDGELQDRKKVRVEVEQGETSVPP
GSALVGPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMQCE
CTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKK
GWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQK
GNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFC
GSANCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALMENGEGLSDKNQVLSLSR
LMVRIETLEQKLTCLELIQNTHSQSCLKSFLERHGLSLLWIWMAELGDGRESNQKLQEEI
IKTLEHLPIPTKNMLEESKVLPIIQRWSQTKTAVPPLSEGDGYSSENTSRAHTPLNTPDP
STKLSTEADTDTPKKLMFRRLKIISENSMDSAISDATSELEGKDGKEDLDQLENVPVEEE
EELQSQQLLPQQLPECKVDSETNIEASKLPTSEPEADAEIEPKESNGTKLEEPINEETPS
QDEEEGVSDVESERSQEQPDKTVDISDLATKLLDSWKDLKEVYRIPKKSQTEKENTTTER
GRDAVGFRDQTPAPKTPNRSRERDPDKQTQNKEKRKRRSSLSPPSSAYERGTKRPDDRYD
TPTSKKKVRIKDRNKLSTEERRKLFEQEVAQREAQKQQQQMQNLGMTSPLPYDSLGYNAP
HHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTEPLSAP
PPVPVVPHVAAPVEVSSSQYVAQSDGVVHQDSSVAVLPVPAPGPVQGQNYSVWDSNQQSV
SVQQQYSPAQSQATIYYQGQTCPTVYGVTSPYSQTTPPIVQSYAQPSLQYIQGQQIFTAH
PQGVVVQPAAAVTTIVAPGQPQPLQPSEMVVTNNLLDLPPPSPPKPKTIVLPPNWKTARD
PEGKIYYYHVITRQTQWDPPTWESPGDDASLEHEAEMDLGTPTYDENPMKASKKPKTAEA
DTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKE
LKYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYKPKEDTELE
GenBank ID Protein 197313748
UniProtKB/Swiss-Prot ID Q9BYW2
UniProtKB/Swiss-Prot Entry Name SETD2_HUMAN
PDB IDs
GenBank Gene ID NM_014159.6
GeneCard ID SETD2
GenAtlas ID SETD2
HGNC ID HGNC:18420
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  5. Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP: Large-scale characterization of HeLa cell nuclear phosphoproteins. Proc Natl Acad Sci U S A. 2004 Aug 17;101(33):12130-5. Epub 2004 Aug 9. [PubMed:15302935 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  8. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  9. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  10. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  11. Zhang QH, Ye M, Wu XY, Ren SX, Zhao M, Zhao CJ, Fu G, Shen Y, Fan HY, Lu G, Zhong M, Xu XR, Han ZG, Zhang JW, Tao J, Huang QH, Zhou J, Hu GX, Gu J, Chen SJ, Chen Z: Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells. Genome Res. 2000 Oct;10(10):1546-60. [PubMed:11042152 ]
  12. Muzny DM, Scherer SE, Kaul R, Wang J, Yu J, Sudbrak R, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Wei S, Wheeler DA, Wright MW, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clendenning J, Clerc-Blankenburg KP, Chen R, Chen Z, Davis C, Delgado O, Dinh HH, Dong W, Draper H, Ernst S, Fu G, Gonzalez-Garay ML, Garcia DK, Gillett W, Gu J, Hao B, Haugen E, Havlak P, He X, Hennig S, Hu S, Huang W, Jackson LR, Jacob LS, Kelly SH, Kube M, Levy R, Li Z, Liu B, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Palmeiri A, Pasternak S, Perez LM, Phelps KA, Plopper FJ, Qiang B, Raymond C, Rodriguez R, Saenphimmachak C, Santibanez J, Shen H, Shen Y, Subramanian S, Tabor PE, Verduzco D, Waldron L, Wang J, Wang J, Wang Q, Williams GA, Wong GK, Yao Z, Zhang J, Zhang X, Zhao G, Zhou J, Zhou Y, Nelson D, Lehrach H, Reinhardt R, Naylor SL, Yang H, Olson M, Weinstock G, Gibbs RA: The DNA sequence, annotation and analysis of human chromosome 3. Nature. 2006 Apr 27;440(7088):1194-8. [PubMed:16641997 ]
  13. Nagase T, Kikuno R, Hattori A, Kondo Y, Okumura K, Ohara O: Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Dec 31;7(6):347-55. [PubMed:11214970 ]
  14. Sun XJ, Wei J, Wu XY, Hu M, Wang L, Wang HH, Zhang QH, Chen SJ, Huang QH, Chen Z: Identification and characterization of a novel human histone H3 lysine 36-specific methyltransferase. J Biol Chem. 2005 Oct 21;280(42):35261-71. Epub 2005 Aug 22. [PubMed:16118227 ]
  15. Li M, Phatnani HP, Guan Z, Sage H, Greenleaf AL, Zhou P: Solution structure of the Set2-Rpb1 interacting domain of human Set2 and its interaction with the hyperphosphorylated C-terminal domain of Rpb1. Proc Natl Acad Sci U S A. 2005 Dec 6;102(49):17636-41. Epub 2005 Nov 28. [PubMed:16314571 ]
  16. Rega S, Stiewe T, Chang DI, Pollmeier B, Esche H, Bardenheuer W, Marquitan G, Putzer BM: Identification of the full-length huntingtin- interacting protein p231HBP/HYPB as a DNA-binding factor. Mol Cell Neurosci. 2001 Jul;18(1):68-79. [PubMed:11461154 ]
  17. Faber PW, Barnes GT, Srinidhi J, Chen J, Gusella JF, MacDonald ME: Huntingtin interacts with a family of WW domain proteins. Hum Mol Genet. 1998 Sep;7(9):1463-74. [PubMed:9700202 ]
  18. Passani LA, Bedford MT, Faber PW, McGinnis KM, Sharp AH, Gusella JF, Vonsattel JP, MacDonald ME: Huntingtin's WW domain partners in Huntington's disease post-mortem brain fulfill genetic criteria for direct involvement in Huntington's disease pathogenesis. Hum Mol Genet. 2000 Sep 1;9(14):2175-82. [PubMed:10958656 ]