Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09039
Secondary Accession Numbers
  • 14781
Name Histone-lysine N-methyltransferase SUV420H2
Synonyms
  1. Lysine N-methyltransferase 5C
  2. Su(var)4-20 homolog 2
  3. Suppressor of variegation 4-20 homolog 2
  4. Suv4-20h2
Gene Name SUV420H2
Protein Type Unknown
Biological Properties
General Function Involved in protein binding
Specific Function Histone methyltransferase that specifically trimethylates 'Lys-20' of histone H4. H4 'Lys-20' trimethylation represents a specific tag for epigenetic transcriptional repression. Mainly functions in pericentric heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin in these regions. SUV420H1 is targeted to histone H3 via its interaction with RB1 family proteins (RB1, RBL1 and RBL2) (By similarity).
Pathways
  • Lysine degradation
Reactions
S-Adenosylmethionine + L-lysine-[histone] → S-Adenosylhomocysteine + N(6)-methyl-L-lysine-[histone] details
Protein lysine + S-Adenosylmethionine → Protein N6-methyl-L-lysine + S-Adenosylhomocysteine details
S-Adenosylmethionine + Protein N6-methyl-L-lysine → S-Adenosylhomocysteine + Protein N6,N6-dimethyl-L-lysine details
S-Adenosylmethionine + Protein N6,N6-dimethyl-L-lysine → S-Adenosylhomocysteine + Protein N6,N6,N6-trimethyl-L-lysine details
GO Classification
Biological Process
histone H4-K20 trimethylation
regulation of transcription, DNA-dependent
transcription, DNA-dependent
Cellular Component
condensed nuclear chromosome, centromeric region
Molecular Function
histone methyltransferase activity (H4-K20 specific)
Cellular Location
  1. Nucleus
  2. Chromosome
Gene Properties
Chromosome Location 19
Locus 19q13.42
SNPs SUV420H2
Gene Sequence
>1389 bp
ATGGGGCCCGACAGAGTGACAGCACGAGAACTGTGCGAGAACGACGACCTGGCCACCAGC
CTCGTCCTGGACCCCTACCTCGGTTTCCGCACCCATAAGATGAACGTCAGCCCTGTGCCC
CCCCTGCGGCGACAGCAGCACCTGCGCTCAGCGCTGGAAACTTTCCTGAGGCAGCGGGAC
CTGGAGGCTGCGTACCGGGCCCTGACGCTGGGAGGCTGGACGGCCCGCTACTTCCAGAGC
CGGGGCCCGCGGCAGGAGGCTGCCCTCAAGACCCACGTCTATCGCTACCTCCGTGCCTTC
CTGCCGGAAAGTGGCTTTACCATCCTGCCCTGCACGCGCTACTCCATGGAGACCAACGGG
GCCAAGATCGTGTCCACTCGTGCTTGGAAAAAGAATGAGAAGCTGGAGCTGCTGGTGGGC
TGCATTGCAGAGCTGCGGGAGGCAGATGAGGGGCTGCTGAGGGCCGGTGAGAATGACTTC
AGCATCATGTACTCAACCCGCAAGCGGAGTGCTCAGCTGTGGCTGGGCCCAGCCGCCTTC
ATCAACCATGACTGCAAACCCAACTGCAAGTTTGTGCCTGCAGATGGGAACGCAGCCTGC
GTGAAGGTGCTCCGGGACATTGAGCCTGGGGACGAGGTGACATGCTTCTACGGCGAGGGC
TTCTTCGGCGAGAAGAATGAGCACTGTGAATGCCACACCTGTGAGAGGAAAGGTGAAGGA
GCTTTCCGAACCAGGCCTAGGGAGCCCGCGTTGCCACCACGGCCCCTGGACAAGTACCAG
CTGCGTGAGACCAAGCGGCGGCTGCAGCAAGGCCTGGACAGTGGCAGCCGACAGGGCCTG
CTGGGCCCTCGGGCCTGCGTGCACCCATCCCCGCTGCGCCGGGACCCATTCTGCGCCGCC
TGCCAGCCCCTGCGCCTGCCAGCCTGCAGCGCCCGCCCAGACACCTCACCCCTCTGGCTC
CAGTGGCTGCCTCAGCCCCAGCCCCGAGTGCGGCCCCGGAAGCGCCGACGCCCCCGGCCC
CGGAGGGCCCCAGTGCTCTCCACCCACCACGCTGCCCGCGTCTCCCTGCACCGATGGGGA
GGCTGTGGCCCCCACTGCCGCCTGCGAGGAGAGGCCCTGGTGGCCCTGGGCCAGCCCCCC
CACGCCCGCTGGGCCCCTCAGCAGGACTGGCACTGGGCCCGGCGCTATGGGCTGCCTTAC
GTGGTGCGTGTGGACCTTCGTCGCCTGGCCCCAGCCCCACCAGCTACCCCAGCCCCTGCT
GGGACCCCAGGCCCCATCCTGATCCCGAAGCAGGCCCTCGCCTTCGCCCCCTTCTCCCCA
CCCAAGCGCCTACGGCTGGTGGTCAGCCACGGCTCCATCGACCTGGATGTCGGCGGTGAA
GAGCTGTGA
Protein Properties
Number of Residues 462
Molecular Weight 52112.445
Theoretical pI 9.834
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Histone-lysine N-methyltransferase SUV420H2
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQQHLRSALETFLRQRD
LEAAYRALTLGGWTARYFQSRGPRQEAALKTHVYRYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECHTCERKGEG
AFRTRPREPALPPRPLDKYQLRETKRRLQQGLDSGSRQGLLGPRACVHPSPLRRDPFCAA
CQPLRLPACSARPDTSPLWLQWLPQPQPRVRPRKRRRPRPRRAPVLSTHHAARVSLHRWG
GCGPHCRLRGEALVALGQPPHARWAPQQDWHWARRYGLPYVVRVDLRRLAPAPPATPAPA
GTPGPILIPKQALAFAPFSPPKRLRLVVSHGSIDLDVGGEEL
GenBank ID Protein 31543169
UniProtKB/Swiss-Prot ID Q86Y97
UniProtKB/Swiss-Prot Entry Name SV422_HUMAN
PDB IDs
GenBank Gene ID NM_032701.3
GeneCard ID SUV420H2
GenAtlas ID SUV420H2
HGNC ID HGNC:28405
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Wan D, Gong Y, Qin W, Zhang P, Li J, Wei L, Zhou X, Li H, Qiu X, Zhong F, He L, Yu J, Yao G, Jiang H, Qian L, Yu Y, Shu H, Chen X, Xu H, Guo M, Pan Z, Chen Y, Ge C, Yang S, Gu J: Large-scale cDNA transfection screening for genes related to cancer development and progression. Proc Natl Acad Sci U S A. 2004 Nov 2;101(44):15724-9. Epub 2004 Oct 21. [PubMed:15498874 ]