Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09043
Secondary Accession Numbers
  • 14785
Name tRNA guanosine-2'-O-methyltransferase TRM11 homolog
Synonyms Not Available
Gene Name TRMT11
Protein Type Unknown
Biological Properties
General Function Involved in nucleic acid binding
Specific Function Catalytic subunit of an S-adenosyl-L-methionine- dependent tRNA methyltransferase complex that mediates the methylation of the guanosine nucleotide at position 10 (m2G10) in tRNAs
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
nucleic acid binding
transferase activity, transferring one-carbon groups
methyltransferase activity
Process
metabolic process
cellular metabolic process
one-carbon metabolic process
methylation
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location Chromosome:6
Locus 6q11.1-q22.33
SNPs TRMT11
Gene Sequence
>1392 bp
ATGGCGCTGTCGTGTACCCTTAACAGGTATCTGCTCCTCATGGCGCAGGAGCATCTGGAG
TTCCGCCTGCCGGAAATAAAGTCTTTGCTTTTGCTTTTTGGAGGTCAGTTTGCCAGCAGT
CAAGAAACTTATGGAAAGTCACCATTTTGGATTCTTAGCATTCCCTCTGAAGATATTGCA
AGAAATTTGATGAAACGGACAGTGTGTGCCAAGTCTATATTTGAACTATGGGGTCATGGA
CAATCTCCTGAGGAGCTGTACAGTTCTCTTAAAAACTACCCTGTGGAGAAGATGGTTCCA
TTTCTACATTCGGACTCTACATATAAAATAAAGATTCACACTTTTAATAAGACATTGACA
CAAGAAGAGAAAATCAAGCGAATAGATGCACTTGAATTTCTGCCATTTGAAGGAAAAGTG
AATTTAAAGAAACCGCAACATGTATTTTCTGTTTTGGAGGATTATGGTTTAGACCCAAAC
TGCATCCCTGAGAATCCACATAATATTTATTTTGGTAGATGGATTGCAGATGGACAGAGA
GAGCTTATTGAGTCATACAGTGTCAAAAAGAGACACTTTATTGGAAATACAAGTATGGAT
GCTGGTTTGTCATTCATTATGGCTAACCATGGAAAAGTGAAAGAAAATGATATTGTCTTT
GATCCATTTGTTGGAACAGGTGGCCTGCTGATAGCATGTGCTCATTTTGGTGCATATGTG
TATGGGACAGACATAGACTACAACACAGTTCATGGCTTGGGAAAGGCTACTAGGAAAAAC
CAGAAGTGGAGAGGACCAGATGAAAACATTAGGGCCAATCTTCGTCAATATGGTTTAGAG
AAGTATTACCTTGATGTCCTGGTTTCAGATGCATCTAAACCTTCCTGGAGGAAGGGCACA
TATTTTGATGCAATCATTACTGATCCTCCATATGGTATCAGAGAATCTACAAGAAGAACA
GGTTCACAGAAGGAGATACCAAAGGGGATAGAAAAATGGGAAAAATGTCCAGAAAGCCAT
GTTCCTGTTTCCTTGAGTTATCATCTGAGTGATATGTTTCTTGACCTGTTAAACTTCGCA
GCTGAGACCCTCGTTTTAGGTGGAAGACTAGTCTATTGGTTACCGGTGTATACGCCAGAA
TACACTGAAGAGATGGTGCCTTGGCACCCTTGCCTGGAACTCGTTAGCAACTGCGAGCAG
AAGCTTTCCAGTCACACATCAAGGCGCTTGATCACAATGGAAAAGGTGAAGAAATTTGAG
AATCGGGACCAGTATTCACATCTGCTAAGTGATCATTTTCTGCCATACCAAGGTCATAAT
TCCTTCCGTGAGAAATATTTTAGTGGGGTAACAAAAAGAATTGCCAAGGAAGAAAAATCC
ACCCAGGAATGA
Protein Properties
Number of Residues 463
Molecular Weight 53420.6
Theoretical pI 7.88
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>tRNA guanosine-2'-O-methyltransferase TRM11 homolog
MALSCTLNRYLLLMAQEHLEFRLPEIKSLLLLFGGQFASSQETYGKSPFWILSIPSEDIA
RNLMKRTVCAKSIFELWGHGQSPEELYSSLKNYPVEKMVPFLHSDSTYKIKIHTFNKTLT
QEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDPNCIPENPHNIYFGRWIADGQR
ELIESYSVKKRHFIGNTSMDAGLSFIMANHGKVKENDIVFDPFVGTGGLLIACAHFGAYV
YGTDIDYNTVHGLGKATRKNQKWRGPDENIRANLRQYGLEKYYLDVLVSDASKPSWRKGT
YFDAIITDPPYGIRESTRRTGSQKEIPKGIEKWEKCPESHVPVSLSYHLSDMFLDLLNFA
AETLVLGGRLVYWLPVYTPEYTEEMVPWHPCLELVSNCEQKLSSHTSRRLITMEKVKKFE
NRDQYSHLLSDHFLPYQGHNSFREKYFSGVTKRIAKEEKSTQE
GenBank ID Protein 94420683
UniProtKB/Swiss-Prot ID Q7Z4G4
UniProtKB/Swiss-Prot Entry Name TRM11_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001031712.2
GeneCard ID TRMT11
GenAtlas ID TRMT11
HGNC ID HGNC:21080
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. [PubMed:15592455 ]