Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09044
Secondary Accession Numbers
  • 14786
Name tRNA:m(4)X modification enzyme TRM13 homolog
Synonyms
  1. Coiled-coil domain-containing protein 76
  2. tRNA [Gm4] methyltransferase
Gene Name TRMT13
Protein Type Unknown
Biological Properties
General Function Involved in methyltransferase activity
Specific Function tRNA methylase which 2'-O-methylates cytidine(4) in tRNA(Pro) and tRNA(Gly)(GCC), and adenosine(4) in tRNA(His) (By similarity).
Pathways Not Available
Reactions
S-Adenosylmethionine + rRNA → S-Adenosylhomocysteine + rRNA containing 2'-O-methyluridine details
S-Adenosylmethionine + cytidine(4) in tRNA(Pro) → S-Adenosylhomocysteine + 2'-O-methylcytidine(4) in tRNA(Pro) details
S-Adenosylmethionine + cytidine(4) in tRNA(Gly)(GCC) → S-Adenosylhomocysteine + 2'-O-methylcytidine(4) in tRNA(Gly)(GCC) details
S-Adenosylmethionine + adenosine(4) in tRNA(His) → S-Adenosylhomocysteine + 2'-O-methyladenosine(4) in tRNA(His) details
GO Classification
Biological Process
tRNA processing
Function
catalytic activity
transferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
Molecular Function
metal ion binding
methyltransferase activity
Process
rna metabolic process
ncrna metabolic process
trna metabolic process
trna processing
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1p21.2
SNPs CCDC76
Gene Sequence
>1446 bp
ATGGCGACCTCCGCGACGTCGCCGCACGCGCCTGGTTTTCCAGCTGAGGGTAGATGCGGT
TACTATGTGGAAAAGAAGAAACGGTTCTGCAGGATGGTGGTGGCCGCAGGGAAAAGATTT
TGTGGTGAACACGCTGGAGCCGCGGAGGAAGAAGATGCTCGGAAAAGAATCCTGTGTCCT
TTAGATCCAAAACACACAGTATATGAAGATCAACTAGCAAAGCATTTGAAAAAATGTAAC
TCAAGAGAGAAACCAAAACCTGATTTCTATATTCAAGATATTAATGCAGGCTTAAGAGAT
GAAACAGAAATACCTGAACAATTAGTTCCAATTTCTTCTCTATCTGAAGAGCAGTTGGAA
AAGTTAATTAAGAAATTGAGAAAAGCAAGTGAAGGCTTGAATTCTACACTTAAAGATCAT
ATTATGTCCCATCCAGCATTACACGATGCACTTAATGACCCTAAAAATGGCGATTCTGCA
ACCAAGCACCTGAAACAGCAGGCTTCTATTTTAGGTAACATTGAAAATTTAAAGTTACTT
GGTCCAAGAAGATGCTTTGTTGAGTTTGGAGCGGGAAAGGGAAAATTATCTCATTGGGTT
GATATTGCCTTAAAAGATGCTGAAAAAGTTCACTTCATCCTAGTGGAAAAGGTGACCACA
AGATTCAAGGTGGATGGAAAACACAGAAAGAAAAATTCAGTGTTTGAAAGACTTCAAATT
GATATTCAACACTTGTGTTTGAACAAGATTCCTGTGCTAAGAGAAGAAAAACTACCTGTG
GTAGGAATTGGAAAGCATCTGTGTGGTATGGCAACAGATCTTGCATTACGATGTTTGGTT
GAAACCTATGCTGCCAGTTTTGAGGAAAGGAATGAAGAACCTTTAGCCAAACGCATAAAG
AATGATAAAACAGAAAAAGAAATTTACACTTTGGCCAAGGAAGGAAATGAAAAAAATGTC
CCAGAGAAGTGGAACCCTGTGGCTGGCATTGTTATTGCACTCTGTTGTCACCACAGGTGT
GATTGGAGACATTATGTGGGCAAAGAATATTTCAGGGCTCTAGGCCTTGGAGCAGTGGAA
TTCCATTATTTCCAGCGAATGAGTAGTTGGGCAACTTGTGGGATGCGGAAAACATCTTTG
GAAACCTCAAATAGTACCACAAAGAGGCAAGATAATCAGAATGATGATAGTGAAGAGCAT
GATGATGGAGGATACAGAATCACAGATGATGGCGCTGATTGTTTGCCTGGGCTTCTTAGT
GTTGAAGAAAAGAAGAAAATAGGGCATCTTTGTAAATTGCTGATTGACCAAGGTCGAATC
CAGTATTTGCAGCAGAAGGGATTCAGTCCTGCTTTGCAGTACTATACAGACCCTCTGGTG
TCTTTGGAAAATGTTTTGTTAACTGCTTTACCAAATCATTCTTCATCACCAGAAACAACT
GCTTAA
Protein Properties
Number of Residues 481
Molecular Weight 54246.57
Theoretical pI 8.093
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>tRNA guanosine-2'-O-methyltransferase TRM13 homolog
MATSATSPHAPGFPAEGRCGYYVEKKKRFCRMVVAAGKRFCGEHAGAAEEEDARKRILCP
LDPKHTVYEDQLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLE
KLIKKLRKASEGLNSTLKDHIMSHPALHDALNDPKNGDSATKHLKQQASILGNIENLKLL
GPRRCFVEFGAGKGKLSHWVDIALKDAEKVHFILVEKVTTRFKVDGKHRKKNSVFERLQI
DIQHLCLNKIPVLREEKLPVVGIGKHLCGMATDLALRCLVETYAASFEERNEEPLAKRIK
NDKTEKEIYTLAKEGNEKNVPEKWNPVAGIVIALCCHHRCDWRHYVGKEYFRALGLGAVE
FHYFQRMSSWATCGMRKTSLETSNSTTKRQDNQNDDSEEHDDGGYRITDDGADCLPGLLS
VEEKKKIGHLCKLLIDQGRIQYLQQKGFSPALQYYTDPLVSLENVLLTALPNHSSSPETT
A
GenBank ID Protein 226493203
UniProtKB/Swiss-Prot ID Q9NUP7
UniProtKB/Swiss-Prot Entry Name TRM13_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_019083.2
GeneCard ID CCDC76
GenAtlas ID CCDC76
HGNC ID HGNC:25502
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Andreeva A, Tidow H: A novel CHHC Zn-finger domain found in spliceosomal proteins and tRNA modifying enzymes. Bioinformatics. 2008 Oct 15;24(20):2277-80. doi: 10.1093/bioinformatics/btn431. Epub 2008 Aug 14. [PubMed:18703587 ]