You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09045
Secondary Accession Numbers
  • 14787
Name tRNA (guanine(26)-N(2))-dimethyltransferase
Synonyms
  1. tRNA 2,2-dimethylguanosine-26 methyltransferase
  2. tRNA(guanine-26,N(2)-N(2)) methyltransferase
  3. tRNA(m(2,2)G26)dimethyltransferase
Gene Name TRMT1
Protein Type Unknown
Biological Properties
General Function Involved in RNA binding
Specific Function Dimethylates a single guanine residue at position 26 of most tRNAs using S-adenosyl-L-methionine as donor of the methyl groups.
Pathways Not Available
Reactions
S-Adenosylmethionine + guanine(26) in tRNA → S-Adenosylhomocysteine + N(2)-dimethylguanine(26) in tRNA details
GO Classification
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
zinc ion binding
transferase activity
nucleic acid binding
trna (guanine-n2-)-methyltransferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
n-methyltransferase activity
rna binding
Molecular Function
tRNA (guanine-N2-)-methyltransferase activity
metal ion binding
zinc ion binding
RNA binding
Process
rna metabolic process
ncrna metabolic process
trna metabolic process
trna processing
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
Cellular Location
  1. Cytoplasmic
Gene Properties
Chromosome Location 19
Locus 19p13.2
SNPs TRMT1
Gene Sequence
>1980 bp
ATGCAAGGATCGTCTCTGTGGCTAAGCCTCACTTTCCGCTCCGCCCGGGTGCTCTCTAGA
GCCCGGTTTTTCGAGTGGCAGTCTCCAGGGCTGCCGAATACAGCAGCGATGGAGAACGGC
ACCGGGCCCTACGGAGAAGAACGTCCACGTGAAGTCCAGGAGACGACAGTCACCGAGGGG
GCTGCCAAAATCGCCTTTCCCAGTGCCAACGAGGTCTTTTATAACCCGGTGCAGGAATTC
AATCGGGACCTGACATGTGCTGTGATCACCGAGTTTGCTCGCATTCAGCTTGGGGCCAAA
GGAATCCAGATCAAGGTTCCAGGAGAGAAGGACACGCAAAAAGTGGTCGTGGACTTGTCA
GAGCAAGAGGAGGAAAAGGTTGAACTGAAAGAGAGTGAAAACCTGGCCTCAGGAGACCAA
CCTCGCACAGCGGCCGTGGGGGAGATCTGTGAGGAAGGCCTGCATGTGCTGGAAGGCCTG
GCAGCTTCAGGCCTACGTTCCATTCGATTTGCCCTAGAGGTGCCTGGGCTCAGATCTGTG
GTTGCAAACGATGCCTCCACCCGGGCTGTGGATCTCATACGCCGGAATGTCCAGCTCAAT
GACGTGGCCCACCTGGTACAGCCGAGCCAAGCAGATGCCCGGATGCTGATGTACCAGCAC
CAGAGGGTGTCGGAGAGGTTTGACGTCATCGATCTGGACCCCTATGGCAGCCCAGCCACC
TTCCTGGATGCAGCTGTGCAGGCTGTGAGTGAAGGAGGGTTGCTGTGTGTGACCTGCACA
GACATGGCGGTGTTGGCGGGGAACAGCGGGGAGACGTGCTACAGCAAGTACGGGGCCATG
GCCCTCAAGAGCCGGGCCTGCCACGAGATGGCCCTGAGAATCGTCCTGCACAGCCTGGAC
CTCCGCGCCAACTGCTACCAGCGCTTCGTGGTGCCGCTGCTCAGCATCAGCGCTGACTTC
TACGTGCGTGTTTTTGTCCGTGTCTTCACCGGCCAGGCCAAGGTCAAGGCCTCAGCCAGC
AAGCAGGCGCTGGTGTTCCAGTGTGTGGGCTGCGGGGCCTTCCACCTTCAGCGTCTCGGC
AAAGCGTCAGGAGTCCCCAGCGGCCGGGCCAAGTTCTCTGCAGCCTGTGGTCCCCCTGTG
ACCCCCGAGTGTGAACACTGTGGGCAACGACACCAGCTTGGTGGCCCCATGTGGGCAGAG
CCCATCCATGACCTGGATTTTGTGGGCCGTGTCCTGGAGGCTGTGAGCGCTAACCCCGGC
CGCTTCCACACCTCGGAGCGGATCCGAGGGGTCCTGAGCGTCATCACTGAGGAGCTCCCG
GACGTGCCTCTGTACTACACCCTGGACCAGCTGAGCAGCACCATCCACTGCAACACACCA
AGCCTCCTGCAGTTGCGGTCGGCCCTCCTCCACGCTGACTTCCGGGTCTCACTCTCCCAC
GCCTGTAAGAACGCTGTGAAGACGGATGCCCCTGCCTCTGCCCTCTGGGACATCATGCGT
TGCTGGGAGAAGGAATGTCCGGTGAAACGGGAGCGACTATCAGAGACTAGCCCAGCGTTC
CGCATTCTCAGTGTGGAGCCCAGGCTGCAGGCCAACTTCACCATCCGGGAAGATGCCAAC
CCCAGCTCCCGACAGCGAGGACTCAAGCGCTTCCAGGCTAACCCGGAGGCCAACTGGGGT
CCCCGGCCTCGTGCCCGGCCAGGGGGCAAGGCGGCCGACGAAGCTATGGAGGAGAGACGC
AGGCTGCTTCAGAACAAGCGGAAGGAGCCGCCGGAAGATGTGGCCCAGCGGGCTGCCCGG
CTCAAGACATTTCCTTGCAAGAGGTTTAAGGAGGGCACCTGTCAACGCGGGGACCAGTGC
TGCTACTCCCACAGCCCCCCGACACCCAGGGTTTCTGCTGATGCTGCCCCTGACTGTCCA
GAGACCTCCAACCAGACCCCCCCTGGACCTGGGGCTGCCGCTGGGCCAGGCATAGACTGA
Protein Properties
Number of Residues 659
Molecular Weight 72233.35
Theoretical pI 7.638
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>N(2),N(2)-dimethylguanosine tRNA methyltransferase
MQGSSLWLSLTFRSARVLSRARFFEWQSPGLPNTAAMENGTGPYGEERPREVQETTVTEG
AAKIAFPSANEVFYNPVQEFNRDLTCAVITEFARIQLGAKGIQIKVPGEKDTQKVVVDLS
EQEEEKVELKESENLASGDQPRTAAVGEICEEGLHVLEGLAASGLRSIRFALEVPGLRSV
VANDASTRAVDLIRRNVQLNDVAHLVQPSQADARMLMYQHQRVSERFDVIDLDPYGSPAT
FLDAAVQAVSEGGLLCVTCTDMAVLAGNSGETCYSKYGAMALKSRACHEMALRIVLHSLD
LRANCYQRFVVPLLSISADFYVRVFVRVFTGQAKVKASASKQALVFQCVGCGAFHLQRLG
KASGVPSGRAKFSAACGPPVTPECEHCGQRHQLGGPMWAEPIHDLDFVGRVLEAVSANPG
RFHTSERIRGVLSVITEELPDVPLYYTLDQLSSTIHCNTPSLLQLRSALLHADFRVSLSH
ACKNAVKTDAPASALWDIMRCWEKECPVKRERLSETSPAFRILSVEPRLQANFTIREDAN
PSSRQRGLKRFQANPEANWGPRPRARPGGKAADEAMEERRRLLQNKRKEPPEDVAQRAAR
LKTFPCKRFKEGTCQRGDQCCYSHSPPTPRVSADAAPDCPETSNQTPPGPGAAAGPGID
GenBank ID Protein 209862871
UniProtKB/Swiss-Prot ID Q9NXH9
UniProtKB/Swiss-Prot Entry Name TRM1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001136035.2
GeneCard ID TRMT1
GenAtlas ID TRMT1
HGNC ID HGNC:25980
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  5. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  6. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  7. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824 ]
  8. Liu J, Straby KB: The human tRNA(m(2)(2)G(26))dimethyltransferase: functional expression and characterization of a cloned hTRM1 gene. Nucleic Acids Res. 2000 Sep 15;28(18):3445-51. [PubMed:10982862 ]