You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09046
Secondary Accession Numbers
  • 14788
Name tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A
Synonyms
  1. tRNA(m1A58)-methyltransferase subunit TRMT61A
  2. tRNA(m1A58)MTase subunit TRMT61A
Gene Name TRMT61A
Protein Type Unknown
Biological Properties
General Function Involved in tRNA (adenine-N1-)-methyltransferase activity
Specific Function Catalytic subunit of tRNA (adenine-N(1)-)-methyltransferase, which catalyzes the formation of N(1)-methyladenine at position 58 (m1A58) in initiator methionyl-tRNA.
Pathways Not Available
Reactions
S-Adenosylmethionine + adenine(58) in tRNA → S-Adenosylhomocysteine + N(1)-methyladenine(58) in tRNA details
GO Classification
Cellular Component
tRNA (m1A) methyltransferase complex
nucleus
Function
catalytic activity
transferase activity
rna methyltransferase activity
trna methyltransferase activity
trna (adenine) methyltransferase activity
trna (adenine-n1-)-methyltransferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
Molecular Function
tRNA (adenine-N1-)-methyltransferase activity
Process
rna metabolic process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
rna modification
rna methylation
trna methylation
Cellular Location
  1. Nucleus
Gene Properties
Chromosome Location 14
Locus 14q32
SNPs TRMT61A
Gene Sequence
>870 bp
ATGAGCTTCGTGGCATACGAGGAGCTGATCAAGGAGGGTGACACGGCCATCCTGTCACTG
GGCCATGGTGCAATGGTGGCAGTGCGTGTGCAGCGTGGGGCACAGACCCAGACCCGGCAT
GGTGTCCTGCGGCACTCAGTTGACCTTATCGGCCGCCCCTTCGGCTCCAAGGTGACGTGC
GGCCGAGGTGGCTGGGTGTATGTGCTGCACCCCACGCCCGAGCTCTGGACGCTGAACCTG
CCGCACCGCACGCAGATCCTCTACTCCACAGACATCGCCCTCATCACCATGATGTTGGAG
CTTCGGCCCGGCTCTGTGGTCTGTGAGTCTGGCACCGGCAGTGGCTCTGTGTCCCACGCC
ATCATCCGCACCATTGCACCCACGGGTCACCTGCACACGGTGGAGTTCCACCAGCAGCGG
GCAGAGAAGGCCCGGGAGGAGTTCCAGGAGCACCGTGTGGGCCGCTGGGTGACTGTGCGC
ACCCAGGACGTGTGCCGCAGTGGCTTTGGCGTGAGCCACGTGGCCGACGCCGTCTTCCTG
GACATCCCATCACCCTGGGAGGCCGTGGGCCACGCCTGGGACGCCCTCAAGGTCGAAGGC
GGGCGCTTCTGCTCCTTCTCACCGTGCATCGAGCAGGTGCAACGCACATGCCAGGCGCTG
GCAGCGCGCGGCTTCTCAGAGCTGAGCACCCTGGAGGTGCTGCCACAGGTCTACAACGTG
CGCACTGTCAGCCTGCCACCGCCCGACCTGGGCACAGGCACAGATGGCCCTGCCGGCTCC
GACACCAGCCCCTTCCGCAGCGGCACGCCCATGAAGGAGGCCGTGGGCCACACCGGCTAC
CTGACCTTCGCCACCAAGACCCCAGGCTAG
Protein Properties
Number of Residues 289
Molecular Weight 31381.48
Theoretical pI 7.358
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>tRNA (adenine-N(1)-)-methyltransferase catalytic subunit TRMT61A
MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTC
GRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHA
IIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRTQDVCRSGFGVSHVADAVFL
DIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAARGFSELSTLEVLPQVYNV
RTVSLPPPDLGTGTDGPAGSDTSPFRSGTPMKEAVGHTGYLTFATKTPG
GenBank ID Protein 123173772
UniProtKB/Swiss-Prot ID Q96FX7
UniProtKB/Swiss-Prot Entry Name TRM61_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_152307.2
GeneCard ID TRMT61A
GenAtlas ID TRMT61A
HGNC ID HGNC:23790
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  5. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [PubMed:12508121 ]
  6. Ozanick S, Krecic A, Andersland J, Anderson JT: The bipartite structure of the tRNA m1A58 methyltransferase from S. cerevisiae is conserved in humans. RNA. 2005 Aug;11(8):1281-90. [PubMed:16043508 ]