Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09049
Secondary Accession Numbers
  • 14791
Name tRNA (guanine(37)-N1)-methyltransferase
Synonyms
  1. M1G-methyltransferase
  2. TRM5
  3. tRNA [GM37] methyltransferase
  4. tRNA methyltransferase 5
  5. tRNA methyltransferase 5 homolog
Gene Name TRMT5
Protein Type Unknown
Biological Properties
General Function Involved in tRNA (guanine-N1-)-methyltransferase activity
Specific Function Specifically methylates the N1 position of guanosine-37 in various cytoplasmic and mitochondrial tRNAs. Methylation is not dependent on the nature of the nucleoside 5' of the target nucleoside. This is the first step in the biosynthesis of wybutosine (yW), a modified base adjacent to the anticodon of tRNAs and required for accurate decoding.
Pathways Not Available
Reactions
S-Adenosylmethionine + guanine(37) in tRNA → S-Adenosylhomocysteine + N(1)-methylguanine(37) in tRNA details
GO Classification
Cellular Component
mitochondrial matrix
nucleus
Molecular Function
tRNA (guanine(37)-N(1))-methyltransferase activity
Cellular Location
  1. Cytoplasm (Probable)
Gene Properties
Chromosome Location 14
Locus 14q23.1
SNPs TRMT5
Gene Sequence
>1530 bp
ATGGTGCTTTGGATCTTATGGAGGCCATTTGGATTCTCAGGAAGATTTCTGAAACTGGAA
AGCCATAGCATAACTGAATCAAAATCGTTGATTCCAGTAGCTTGGACATCCCTGACACAG
ATGCTTTTGGAAGCACCTGGTATTTTCTTATTGGGTCAAAGAAAAAGATTCTCAACCATG
CCAGAAACAGAAACACATGAGAGAGAGACTGAATTGTTTTCACCACCTTCTGATGTCCGA
GGCATGACAAAACTTGATAGAACAGCTTTTAAAAAGACAGTCAACATTCCAGTGCTTAAA
GTGAGGAAAGAAATAGTCAGTAAATTGATGCGATCCCTAAAAAGGGCAGCATTGCAGCGC
CCAGGCATAAGACGTGTGATTGAAGATCCGGAAGATAAAGAAAGTAGACTAATCATGTTG
GATCCCTATAAAATATTTACTCATGATTCCTTTGAGAAAGCAGAACTCAGTGTTTTAGAG
CAGCTTAATGTCAGTCCACAGATCTCTAAATACAATTTGGAACTAACATATGAACACTTT
AAGTCAGAAGAAATCTTGAGAGCTGTGCTTCCTGAAGGTCAAGATGTAACTTCAGGGTTT
AGCAGGATTGGACATATTGCACACCTAAACCTTCGAGATCATCAGCTGTCTTTCAAACAT
TTAATTGGCCAGGTTATGATTGACAAAAATCCAGGAATCACCTCAGCAGTAAATAAAATA
AATAATATTGACAATATGTACCGAAATTTCCAAATGGAAGTGCTATCTGGAGAGCAGAAC
ATGATGACAAAGGTTCGAGAAAACAACTACACCTATGAATTTGATTTTTCAAAAGTCTAT
TGGAATCCTCGTCTGTCTACAGAACACAGCCGTATCACAGAACTTCTCAAACCTGGGGAT
GTCCTATTTGATGTTTTTGCTGGGGTTGGGCCCTTTGCCATTCCAGTAGCAAAGAAAAAC
TGCACTGTATTTGCCAATGATCTCAATCCTGAATCTCATAAATGGCTGTTGTACAACTGT
AAATTAAATAAAGTGGACCAAAAGGTGAAAGTCTTCAACTTGGATGGGAAAGACTTCCTC
CAAGGACCAGTCAAAGAAGAGTTAATGCAGCTGCTGGGTCTGTCAAAAGAAAGAAAACCC
TCTGTGCACGTTGTCATGAACTTGCCAGCAAAAGCTATAGAGTTTCTTAGTGCTTTCAAG
TGGCTTTTAGATGGGCAGCCATGCAGCAGTGAGTTCCTTCCCATAGTGCATTGTTATAGC
TTTTCCAAAGATGCTAACCCTGCTGAGGATGTTCGGCAAAGGGCTGGAGCTGTGTTAGGC
ATTTCTCTGGAGGCATGCAGTTCAGTTCACCTGGTAAGAAATGTGGCCCCAAACAAGGAA
ATGCTGTGCATCACGTTTCAGATTCCTGCCTCTGTCCTCTACAAGAACCAGACCAGAAAT
CCAGAGAATCATGAAGATCCACCTCTTAAAAGGCAGAGGACGGCTGAAGCCTTTTCAGAC
GAAAAAACACAAATTGTTTCAAACACTTAA
Protein Properties
Number of Residues 509
Molecular Weight 58245.73
Theoretical pI 8.61
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>tRNA (guanine-N(1)-)-methyltransferase
MVLWILWRPFGFSGRFLKLESHSITESKSLIPVAWTSLTQMLLEAPGIFLLGQRKRFSTM
PETETHERETELFSPPSDVRGMTKLDRTAFKKTVNIPVLKVRKEIVSKLMRSLKRAALQR
PGIRRVIEDPEDKESRLIMLDPYKIFTHDSFEKAELSVLEQLNVSPQISKYNLELTYEHF
KSEEILRAVLPEGQDVTSGFSRIGHIAHLNLRDHQLSFKHLIGQVMIDKNPGITSAVNKI
NNIDNMYRNFQMEVLSGEQNMMTKVRENNYTYEFDFSKVYWNPRLSTEHSRITELLKPGD
VLFDVFAGVGPFAIPVAKKNCTVFANDLNPESHKWLLYNCKLNKVDQKVKVFNLDGKDFL
QGPVKEELMQLLGLSKERKPSVHVVMNLPAKAIEFLSAFKWLLDGQPCSSEFLPIVHCYS
FSKDANPAEDVRQRAGAVLGISLEACSSVHLVRNVAPNKEMLCITFQIPASVLYKNQTRN
PENHEDPPLKRQRTAEAFSDEKTQIVSNT
GenBank ID Protein 145275187
UniProtKB/Swiss-Prot ID Q32P41
UniProtKB/Swiss-Prot Entry Name TRMT5_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_020810.2
GeneCard ID TRMT5
GenAtlas ID TRMT5
HGNC ID HGNC:23141
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  3. Heilig R, Eckenberg R, Petit JL, Fonknechten N, Da Silva C, Cattolico L, Levy M, Barbe V, de Berardinis V, Ureta-Vidal A, Pelletier E, Vico V, Anthouard V, Rowen L, Madan A, Qin S, Sun H, Du H, Pepin K, Artiguenave F, Robert C, Cruaud C, Bruls T, Jaillon O, Friedlander L, Samson G, Brottier P, Cure S, Segurens B, Aniere F, Samain S, Crespeau H, Abbasi N, Aiach N, Boscus D, Dickhoff R, Dors M, Dubois I, Friedman C, Gouyvenoux M, James R, Madan A, Mairey-Estrada B, Mangenot S, Martins N, Menard M, Oztas S, Ratcliffe A, Shaffer T, Trask B, Vacherie B, Bellemere C, Belser C, Besnard-Gonnet M, Bartol-Mavel D, Boutard M, Briez-Silla S, Combette S, Dufosse-Laurent V, Ferron C, Lechaplais C, Louesse C, Muselet D, Magdelenat G, Pateau E, Petit E, Sirvain-Trukniewicz P, Trybou A, Vega-Czarny N, Bataille E, Bluet E, Bordelais I, Dubois M, Dumont C, Guerin T, Haffray S, Hammadi R, Muanga J, Pellouin V, Robert D, Wunderle E, Gauguet G, Roy A, Sainte-Marthe L, Verdier J, Verdier-Discala C, Hillier L, Fulton L, McPherson J, Matsuda F, Wilson R, Scarpelli C, Gyapay G, Wincker P, Saurin W, Quetier F, Waterston R, Hood L, Weissenbach J: The DNA sequence and analysis of human chromosome 14. Nature. 2003 Feb 6;421(6923):601-7. Epub 2003 Jan 1. [PubMed:12508121 ]
  4. Nagase T, Kikuno R, Ishikawa KI, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Feb 28;7(1):65-73. [PubMed:10718198 ]
  5. Brule H, Elliott M, Redlak M, Zehner ZE, Holmes WM: Isolation and characterization of the human tRNA-(N1G37) methyltransferase (TRM5) and comparison to the Escherichia coli TrmD protein. Biochemistry. 2004 Jul 20;43(28):9243-55. [PubMed:15248782 ]