Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09050
Secondary Accession Numbers
  • 14792
Name tRNA wybutosine-synthesizing protein 2 homolog
Synonyms
  1. tRNA methyltransferase 12
  2. tRNA-yW-synthesizing protein 2
Gene Name TRMT12
Protein Type Unknown
Biological Properties
General Function Involved in methyltransferase activity
Specific Function Probable S-adenosyl-L-methionine-dependent methyltransferase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:8
Locus 8q24.13
SNPs TRMT12
Gene Sequence
>1347 bp
ATGAGAGAGAATGTGGTTGTTAGCAACATGGAGAGAGAAAGTGGGAAGCCCGTGGCTGTT
GTCGCAGTTGTGACTGAGCCTTGGTTTACCCAGCGATACAGAGAATATCTCCAGAGGCAG
AAACTCTTTGATACACAGCACCGTGTGGAAAAGATGCCGGATGGCTCGGTGGCGCTACCG
GTGCTGGGAGAGACGCTTCCAGAGCAGCACCTGCAGGAGCTGAGGAATCGTGTTGCCCCA
GGCAGTCCCTGTATGCTCACGCAGCTCCCGGATCCTGTTCCTTCGAAGAGGGCCCAGGGT
TGTTCACCTGCCCAAAAATTGTGTCTTGAGGTGAGTCGCTGGGTGGAGGGTCGGGGAGTC
AAGTGGTCAGCCGAGTTGGAGGCTGATTTGCCCCGATCATGGCAACGGCATGGTAATCTC
TTGTTGCTGAGTGAAGACTGTTTCCAAGCCAAGCAGTGGAAAAATCTGGGACCGGAACTC
TGGGAGACCGTTGCCTTGGCACTTGGCGTCCAGCGTTTGGCAAAACGAGGGCGGGTATCA
CCGGATGGTACTCGAACTCCAGCAGTGACACTGCTGCTGGGTGACCATGGCTGGGTAGAG
CATGTGGATAATGGTATCCGTTATAAGTTTGACGTGACCCAGTGTATGTTCTCCTTTGGA
AACATCACTGAGAAGCTTCGAGTGGCATCGTTGTCCTGTGCTGGAGAAGTGCTGGTGGAT
CTCTATGCAGGGATTGGTTATTTTACATTGCCTTTCCTAGTTCATGCTGGTGCTGCCTTC
GTCCATGCTTGTGAGTGGAATCCCCATGCTGTAGTTGCTCTGAGAAATAACCTTGAGATC
AATGGAGTAGCAGATCGGTGCCAAATACACTTTGGAGATAACAGAAAACTGAAGCTCTCA
AATATTGCAGATAGGGTGATCCTGGGGCTGATTCCCAGCTCTGAAGAAGGCTGGCCCATT
GCCTGCCAAGTGTTAAGGCAGGATGCTGGAGGCATTTTGCATATCCACCAAAATGTGGAA
TCTTCCCCAGGGAAGAATCTTCAGGCTCTTGGAGTCAGCAAAGTAGAGAAAGAGCATTGG
CTGTATCCTCAGCAAATTACCACCAACCAATGGAAAAATGGAGCTACCAGGGATTCTAGG
GGAAAAATGCTGTCACCAGCCACCAAGCCAGAGTGGCAAAGGTGGGCAGAATCTGCAGAA
ACTCGAATCGCCACTCTTCTTCAGCAGGTGCATGGGAAACCATGGAAGACACAAATTCTG
CACATCCAACCAGTGAAATCCTATGCTCCCCATGTGGATCACATAGTCCTGGATCTGGAA
TGCTGCCCCTGTCCTTCAGTTGGCTAG
Protein Properties
Number of Residues 448
Molecular Weight 50235.3
Theoretical pI 8.05
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>tRNA wybutosine-synthesizing protein 2 homolog
MRENVVVSNMERESGKPVAVVAVVTEPWFTQRYREYLQRQKLFDTQHRVEKMPDGSVALP
VLGETLPEQHLQELRNRVAPGSPCMLTQLPDPVPSKRAQGCSPAQKLCLEVSRWVEGRGV
KWSAELEADLPRSWQRHGNLLLLSEDCFQAKQWKNLGPELWETVALALGVQRLAKRGRVS
PDGTRTPAVTLLLGDHGWVEHVDNGIRYKFDVTQCMFSFGNITEKLRVASLSCAGEVLVD
LYAGIGYFTLPFLVHAGAAFVHACEWNPHAVVALRNNLEINGVADRCQIHFGDNRKLKLS
NIADRVILGLIPSSEEGWPIACQVLRQDAGGILHIHQNVESFPGKNLQALGVSKVEKEHW
LYPQQITTNQWKNGATRDSRGKMLSPATKPEWQRWAESAETRIATLLQQVHGKPWKTQIL
HIQPVKSYAPHVDHIVLDLECCPCPSVG
GenBank ID Protein 7021077
UniProtKB/Swiss-Prot ID Q53H54
UniProtKB/Swiss-Prot Entry Name TYW2_HUMAN
PDB IDs Not Available
GenBank Gene ID AK000779
GeneCard ID TRMT12
GenAtlas ID TRMT12
HGNC ID HGNC:26091
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]