You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09052
Secondary Accession Numbers
  • 14794
Name Amiloride-sensitive cation channel 1, neuronal
Synonyms
  1. ASIC2
  2. Acid-sensing ion channel 2
  3. Amiloride-sensitive brain sodium channel
  4. Amiloride-sensitive cation channel neuronal 1
  5. BNC1
  6. BNaC1
  7. Brain sodium channel 1
  8. Mammalian degenerin homolog
Gene Name ACCN1
Protein Type Unknown
Biological Properties
General Function Involved in ligand-gated sodium channel activity
Specific Function Cation channel with high affinity for sodium, which is gated by extracellular protons and inhibited by the diuretic amiloride. Also permeable for Li(+) and K(+). Generates a biphasic current with a fast inactivating and a slow sustained phase. Heteromeric channel assembly seems to modulate
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
sodium channel activity
amiloride-sensitive sodium channel activity
transporter activity
ion channel activity
cation channel activity
Process
sodium ion transport
establishment of localization
transport
monovalent inorganic cation transport
ion transport
cation transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 17q12
SNPs ACCN1
Gene Sequence
>1539 bp
ATGGACCTCAAGGAAAGCCCCAGTGAGGGCAGCCTGCAACCTTCTAGCATCCAGATCTTT
GCCAACACCTCCACCCTCCATGGCATCCGCCACATCTTCGTGTATGGGCCGCTGACCATC
CGGCGTGTGCTGTGGGCAGTGGCCTTCGTGGGCTCTCTGGGCCTGCTGCTGGTGGAGAGC
TCTGAGAGGGTGTCCTACTACTTCTCCTACCAGCATGTCACTAAGGTGGACGAAGTGGTG
GCTCAAAGCCTGGTCTTCCCAGCTGTGACCCTCTGTAACCTGAATGGCTTCCGGTTCTCC
AGGCTCACCACCAATGACCTGTACCATGCTGGGGAGCTGCTGGCCCTGCTGGATGTCAAC
CTGCAGATCCCGGACCCCCATCTGGCTGACCCCTCCGTGCTGGAGGCCCTGCGGCAGAAG
GCCAACTTCAAGCACTACAAACCCAAGCAGTTCAGCATGCTGGAGTTCCTGCACCGTGTG
GGCCATGACCTGAAGGATATGATGCTCTACTGCAAGTTCAAAGGGCAGGAGTGCGGCCAC
CAAGACTTCACCACAGTGTTTACAAAATATGGGAAGTGTTACATGTTTAACTCAGGCGAG
GATGGCAAACCTCTGCTCACCACGGTCAAGGGGGGGACAGGCAACGGGCTGGAGATCATG
CTGGACATTCAGCAGGATGAGTACCTGCCCATCTGGGGAGAGACAGAGGAAACGACATTT
GAAGCAGGAGTGAAAGTTCAGATCCACAGTCAGTCTGAGCCACCTTTCATCCAAGAGCTG
GGCTTTGGGGTGGCTCCAGGGTTCCAGACCTTTGTGGCCACACAGGAGCAGAGGCTCACA
TACCTGCCCCCACCGTGGGGTGAGTGCCGATCCTCAGAGATGGGCCTCGACTTTTTTCCT
GTTTACAGCATCACCGCCTGTAGGATTGACTGTGAGACCCGCTACATTGTGGAAAACTGC
AACTGCCGCATGGTTCACATGCCAGGGGATGCCCCTTTTTGTACCCCTGAGCAGCACAAG
GAGTGTGCAGAGCCTGCCCTAGGTCTGTTGGCGGAAAAGGACAGCAATTACTGTCTCTGC
AGGACACCCTGCAACCTAACCCGCTACAACAAAGAGCTCTCCATGGTGAAGATCCCCAGC
AAGACATCAGCCAAGTACCTTGAGAAGAAATTTAACAAATCAGAAAAATATATCTCAGAG
AACATCCTTGTTCTGGATATATTTTTTGAAGCTCTCAATTATGAGACAATTGAACAGAAG
AAGGCGTATGAAGTTGCTGCCTTACTTGGTGATATTGGTGGTCAGATGGGATTGTTCATT
GGTGCTAGTATCCTTACAATACTAGAGCTCTTTGATTATATTTATGAGCTGATCAAAGAG
AAGCTATTAGACCTGCTTGGCAAAGAGGAGGACGAAGGGAGCCACGATGAGAATGTGAGT
ACTTGTGACACAATGCCAAACCACTCTGAAACCATCAGTCACACTGTGAACGTGCCCCTG
CAGACGACCCTGGGGACCTTGGAGGAGATTGCCTGCTGA
Protein Properties
Number of Residues 512
Molecular Weight 57708.5
Theoretical pI 4.84
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 38-58
  • 428-448
Protein Sequence
>Amiloride-sensitive cation channel 1, neuronal
MDLKESPSEGSLQPSSIQIFANTSTLHGIRHIFVYGPLTIRRVLWAVAFVGSLGLLLVES
SERVSYYFSYQHVTKVDEVVAQSLVFPAVTLCNLNGFRFSRLTTNDLYHAGELLALLDVN
LQIPDPHLADPSVLEALRQKANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGH
QDFTTVFTKYGKCYMFNSGEDGKPLLTTVKGGTGNGLEIMLDIQQDEYLPIWGETEETTF
EAGVKVQIHSQSEPPFIQELGFGVAPGFQTFVATQEQRLTYLPPPWGECRSSEMGLDFFP
VYSITACRIDCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALGLLAEKDSNYCLC
RTPCNLTRYNKELSMVKIPSKTSAKYLEKKFNKSEKYISENILVLDIFFEALNYETIEQK
KAYEVAALLGDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENVS
TCDTMPNHSETISHTVNVPLQTTLGTLEEIAC
GenBank ID Protein 9998944
UniProtKB/Swiss-Prot ID Q16515
UniProtKB/Swiss-Prot Entry Name ACCN1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001094.4
GeneCard ID ACCN1
GenAtlas ID ACCN1
HGNC ID HGNC:99
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  3. Hruska-Hageman AM, Wemmie JA, Price MP, Welsh MJ: Interaction of the synaptic protein PICK1 (protein interacting with C kinase 1) with the non-voltage gated sodium channels BNC1 (brain Na+ channel 1) and ASIC (acid-sensing ion channel). Biochem J. 2002 Feb 1;361(Pt 3):443-50. [PubMed:11802773 ]
  4. Price MP, Snyder PM, Welsh MJ: Cloning and expression of a novel human brain Na+ channel. J Biol Chem. 1996 Apr 5;271(14):7879-82. [PubMed:8626462 ]
  5. Waldmann R, Champigny G, Voilley N, Lauritzen I, Lazdunski M: The mammalian degenerin MDEG, an amiloride-sensitive cation channel activated by mutations causing neurodegeneration in Caenorhabditis elegans. J Biol Chem. 1996 May 3;271(18):10433-6. [PubMed:8631835 ]
  6. Garcia-Anoveros J, Derfler B, Neville-Golden J, Hyman BT, Corey DP: BNaC1 and BNaC2 constitute a new family of human neuronal sodium channels related to degenerins and epithelial sodium channels. Proc Natl Acad Sci U S A. 1997 Feb 18;94(4):1459-64. [PubMed:9037075 ]
  7. Babinski K, Catarsi S, Biagini G, Seguela P: Mammalian ASIC2a and ASIC3 subunits co-assemble into heteromeric proton-gated channels sensitive to Gd3+. J Biol Chem. 2000 Sep 15;275(37):28519-25. [PubMed:10842183 ]