Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09055
Secondary Accession Numbers
  • 14797
Name Amiloride-sensitive cation channel 4
Synonyms
  1. ASIC4
  2. Acid-sensing ion channel 4
  3. Amiloride-sensitive cation channel 4, pituitary
Gene Name ACCN4
Protein Type Unknown
Biological Properties
General Function Involved in sodium channel activity
Specific Function Probable cation channel with high affinity for sodium. In vitro, has no proton-gated channel activity
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
sodium channel activity
transporter activity
ion channel activity
cation channel activity
Process
sodium ion transport
establishment of localization
transport
monovalent inorganic cation transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 2q35
SNPs ACCN4
Gene Sequence
>1944 bp
ATGCTGAGCGGAGCGGCTGGGGCTGCGCGGCGTGGCGGAGCAGCGCTCGCTCCCTCGCTC
ACTCGCTCGCTCGCAGGGACACACGCAGGGGCTGACAGCTGTGCTGGTGCTGATAAGGGA
AGCCACAAGGAGACGATCGAGGAGAGAGACAAGCGGCAGCAGAGGCAGCAGCGGCAGAGG
CAGCACCAGGGCTGCGGAGCTGCTGGGAGTGGGAGTGACTCCCCCACCTCGGGCCCCCAC
CCTGTCCCTGTCCTCTTCCCGCTTGCCCTGAGTTTAGAAGAGCAGCCGCTGCCACCACTG
CCACTCGGGAGGGCACCAGGGCTGCTGGCTAGGGAGGGACAGGGCAGGGAGGCTCTGGCC
AGTCCCAGCAGCCGGGGACAGATGCCGATCGAGATTGTGTGCAAAATCAAATTTGCTGAG
GAGGATGCGAAACCCAAGGAGAAGGAGGCAGGGGATGAGCAGAGCCTCCTCGGGGCTGTT
GCCCCTGGAGCAGCCCCCCGAGACCTGGCCACCTTTGCCAGCACCAGCACCCTGCATGGA
CTGGGCCGGGCCTGTGGCCCAGGCCCCCACGGACTGCGCAGAACCCTGTGGGCACTGGCC
CTACTCACCTCGCTGGCTGCCTTCCTGTACCAGGCGGCTGGCCTGGCCCGGGGCTACCTG
ACCCGGCCTCACCTGGTGGCAATGGACCCCGCTGCCCCAGCCCCAGTGGCGGGCTTCCCG
GCTGTCACCCTCTGCAATATCAACCGCTTCCGGCATTCGGCACTCAGCGATGCCGACATC
TTCCACCTGGCCAATCTGACAGGGCTGCCCCCCAAAGACCGGGATGGGCACCGTGCGGCT
GGCCTGCGCTACCCAGAGCCTGACATGGTAGACATCCTCAACCGCACTGGCCACCAGCTC
GCCGACATGCTTAAGAGCTGCAACTTCAGTGGGCATCACTGCTCCGCCAGCAACTTCTCT
GTGGTCTATACTCGCTATGGGAAGTGTTACACCTTCAACGCGGACCCGCGGAGCTCGCTG
CCCAGCCGGGCAGGGGGCATGGGCAGTGGCCTGGAGATCATGCTGGACATCCAGCAGGAG
GAGTACCTGCCCATCTGGAGGGAGACAAATGAGACGTCGTTTGAGGCAGGTATTCGGGTG
CAGATCCACAGCCAGGAGGAGCCGCCCTACATCCACCAGCTGGGGTTCGGGGTGTCCCCA
GGCTTCCAGACCTTTGTGTCCTGCCAGGAACAGCGGCTGACCTACCTGCCCCAGCCCTGG
GGCAACTGCCGCGCAGAGAGTGAGCTCAGGGAGCCTGAGCTTCAGGGCTACTCGGCCTAC
AGTGTGTCTGCCTGCCGGCTGCGCTGTGAAAAGGAGGCCGTGCTTCAGCGCTGCCACTGC
CGGATGGTGCACATGCCAGACTCCCTGGGTGGGGGCCCTGAGGGCCCGTGCTTCTGCCCC
ACCCCCTGCAACCTGACACGCTATGGGAAAGAGATCTCCATGGTCAGGATCCCCAACAGG
GGCTCAGCCCGGTACCTGGCGAGGAAGTACAACCGCAACGAGACCTACATACGGGAGAAC
TTCCTGGTCCTAGATGTCTTCTTTGAGGCCCTGACCTCTGAAGCCATGGAGCAGCGAGCA
GCCTATGGCCTGTCAGCCCTGCTGGGAGACCTCGGGGGACAGATGGGCCTGTTCATTGGG
GCCAGCATCCTCACGTTGCTGGAGATCCTCGACTACATCTATGAGGTGTCCTGGGATCGA
CTGAAGCGGGTATGGAGGCGTCCCAAGACCCCCCTGCGGACCTCCACTGGGGGCATCTCC
ACTTTGGGGCTTCAGGAGCTGAAGGAACAGAGTCCCTGCCCGAGCCTGGGCCGAGCGGAG
GGTGGGGGGGTCAGCAGTCTGCTCCCCAATCACCACCACCCCCACGGTCCCCCAGGAGGT
CTCTTTGAAGATTTTGCTTGCTAG
Protein Properties
Number of Residues 647
Molecular Weight 70103.9
Theoretical pI 7.87
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 196-216
  • 547-567
Protein Sequence
>Amiloride-sensitive cation channel 4
MLSGAAGAARRGGAALAPSLTRSLAGTHAGADSCAGADKGSHKETIEERDKRQQRQQRQR
QHQGCGAAGSGSDSPTSGPHPVPVLFPLALSLEEQPLPPLPLGRAPGLLAREGQGREALA
SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLATFASTSTLHG
LGRACGPGPHGLRRTLWALALLTSLAAFLYQAAGLARGYLTRPHLVAMDPAAPAPVAGFP
AVTLCNINRFRHSALSDADIFHLANLTGLPPKDRDGHRAAGLRYPEPDMVDILNRTGHQL
ADMLKSCNFSGHHCSASNFSVVYTRYGKCYTFNADPRSSLPSRAGGMGSGLEIMLDIQQE
EYLPIWRETNETSFEAGIRVQIHSQEEPPYIHQLGFGVSPGFQTFVSCQEQRLTYLPQPW
GNCRAESELREPELQGYSAYSVSACRLRCEKEAVLQRCHCRMVHMPDSLGGGPEGPCFCP
TPCNLTRYGKEISMVRIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTSEAMEQRA
AYGLSALLGDLGGQMGLFIGASILTLLEILDYIYEVSWDRLKRVWRRPKTPLRTSTGGIS
TLGLQELKEQSPCPSRGRVEGGGVSSLLPNHHHPHGPPGGLFEDFAC
GenBank ID Protein 14714604
UniProtKB/Swiss-Prot ID Q96FT7
UniProtKB/Swiss-Prot Entry Name ACCN4_HUMAN
PDB IDs Not Available
GenBank Gene ID BC010439
GeneCard ID ACCN4
GenAtlas ID ACCN4
HGNC ID HGNC:21263
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Grunder S, Geissler HS, Bassler EL, Ruppersberg JP: A new member of acid-sensing ion channels from pituitary gland. Neuroreport. 2000 Jun 5;11(8):1607-11. [PubMed:10852210 ]
  4. Grunder S, Geisler HS, Rainier S, Fink JK: Acid-sensing ion channel (ASIC) 4 gene: physical mapping, genomic organisation, and evaluation as a candidate for paroxysmal dystonia. Eur J Hum Genet. 2001 Sep;9(9):672-6. [PubMed:11571555 ]