Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09056
Secondary Accession Numbers
  • 14798
Name Amiloride-sensitive cation channel 5
Synonyms
  1. HINaC
  2. Human intestine Na(+) channel
Gene Name ACCN5
Protein Type Unknown
Biological Properties
General Function Involved in sodium channel activity
Specific Function Cation channel that gives rise to very low constitutive currents in the absence of activation. The activated channel exhibits selectivity for sodium, and is inhibited by amiloride
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
sodium channel activity
transporter activity
ion channel activity
cation channel activity
Process
sodium ion transport
establishment of localization
transport
monovalent inorganic cation transport
ion transport
cation transport
Cellular Location
  1. Cell membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:4
Locus 4q31.3-q32
SNPs ACCN5
Gene Sequence
>1515 bp
ATGGAGCAGACAGAAAAATCAAAAGTATATGCTGAGAACGGACTCTTAGAAAAGATAAAG
CTTTGCCTTTCAAAGAAACCACTGCCATCTCCCACTGAGCGAAAGAAGTTTGACCATGAC
TTTGCCATCTCCACTTCCTTTCATGGGATACACAATATTGTTCAGAACCGGAGCAAAATT
CGCAGGGTGCTCTGGTTGGTGGTGGTTCTGGGCTCAGTCTCACTTGTGACATGGCAGATC
TACATTCGCTTGCTCAACTACTTCACATGGCCAACCACAACGTCCATTGAGGTTCAATAT
GTGGAAAAGATGGAGTTCCCAGCTGTGACATTTTGTAATTTGAATAGGTTCCAAACAGAT
GCTGTAGCCAAATTTGGTGTTATTTTTTTCTTATGGCACATTGTATCCAAAGTCCTCCAT
CTTCAAGAAATTACTGCCAATTCCACTGGCTCTAGAGAGGCTACTGATTTTGCTGCAAGT
CACCAAAACTTCAGCATTGTGGAATTTATCAGGAACAAAGGTTTTTATCTCAACAATAGC
ACTTTGTTGGACTGTGAGTTTTTTGGAAAGCCATGTAGCCCAAAGGATTTTGCACATGTC
TTCACTGAATATGGAAATTGTTTTACTTTTAATCATGGTGAAACTCTCCAAGCAAAGAGA
AAAGTGAGTGTCTCTGGAAGAGGTTTGAGCTTACTCTTCAATGTGAATCAGGAGGCATTC
ACTGATAACCCAGCCCTTGGTTTCGTTGATGCTGGGATCATCTTTGTTATCCATTCACCA
AAGAAGGTGCCACAGTTTGATGGGTTAGGCTTGTTGTCACCTGTGGGAATGCACGCAAGG
GTAACCATCCGCCAAGTGAAGACAGTTCATCAAGAATACCCTTGGGGAGAATGCAATCCT
AACATCAAGCTGCAGAATTTTAGCAGCTACAGCACTTCTGGTTGCTTGAAGGAATGCAAA
GCCCAGCACATAAAAAAGCAATGTGGATGTGTGCCTTTTCTTCTTCCTGGATATGGGATA
GAATGTGACCTACAAAAGTACTTCAGCTGTGTTTCTCCTGTACTTGACCACATTGAATTT
AAGGATTTATGTACAGTAGGAACACATAACTCTAGCTGCCCCGTTTCTTGTGAAGAAATA
GAATACCCGGCCACTATTTCTTATTCCTCTTTTCCAAGTCAAAAAGCTTTGAAATATCTT
TCCAAGAAGTTGAATCAAAGCCGGAAATACATCAGGGAGAATCTTGTAAAAATTGAAATT
AACTATAGTGACCTAAACTATAAGATAACCCAGCAGCAAAAGGCGGTGAGTGTGTCTGAG
TTACTTGCAGATCTTGGTGGTCAGCTGGGTCTATTTTGTGGGGCCAGTCTGATCACGATC
ATAGAAATTATTGAATATCTATTCACCAATTTCTACTGGATATGCATTTTCTTTTTGCTG
AAGATATCTGAAATGACCCAGTGGACTCCTCCACCTCAGAATCATCTGGGAAATAAAAAT
AGGATAGAGGAGTGT
Protein Properties
Number of Residues 505
Molecular Weight 57463.8
Theoretical pI 8.26
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 62-82
  • 460-480
Protein Sequence
>Amiloride-sensitive cation channel 5
MEQTEKSKVYAENGLLEKIKLCLSKKPLPSPTERKKFDHDFAISTSFHGIHNIVQNRSKI
RRVLWLVVVLGSVSLVTWQIYIRLLNYFTWPTTTSIEVQYVEKMEFPAVTFCNLNRFQTD
AVAKFGVIFFLWHIVSKVLHLQEITANSTGSREATDFAASHQNFSIVEFIRNKGFYLNNS
TLLDCEFFGKPCSPKDFAHVFTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAF
TDNPALGFVDAGIIFVIHSPKKVPQFDGLGLLSPVGMHARVTIRQVKTVHQEYPWGECNP
NIKLQNFSSYSTSGCLKECKAQHIKKQCGCVPFLLPGYGIECDLQKYFSCVSPVLDHIEF
KDLCTVGTHNSSCPVSCEEIEYPATISYSSFPSQKALKYLSKKLNQSRKYIRENLVKIEI
NYSDLNYKITQQQKAVSVSELLADLGGQLGLFCGASLITIIEIIEYLFTNFYWICIFFLL
KISEMTQWTPPPQNHLGNKNRIEEC
GenBank ID Protein 7406623
UniProtKB/Swiss-Prot ID Q9NY37
UniProtKB/Swiss-Prot Entry Name ACCN5_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ252011
GeneCard ID ACCN5
GenAtlas ID ACCN5
HGNC ID HGNC:17537
References
General References
  1. Schaefer L, Sakai H, Mattei M, Lazdunski M, Lingueglia E: Molecular cloning, functional expression and chromosomal localization of an amiloride-sensitive Na(+) channel from human small intestine. FEBS Lett. 2000 Apr 14;471(2-3):205-10. [PubMed:10767424 ]