You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09059
Secondary Accession Numbers
  • 14801
Name Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3
Synonyms Not Available
Gene Name HCN3
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Putative hyperpolarization-activated ion channel exhibiting weak selectivity for potassium over sodium ions
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
transporter activity
ion channel activity
cation channel activity
potassium channel activity
voltage-gated potassium channel activity
Process
establishment of localization
transport
transmembrane transport
monovalent inorganic cation transport
potassium ion transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 1q22
SNPs HCN3
Gene Sequence
>2325 bp
ATGGAGGCAGAGCAGCGGCCGGCGGCGGGGGCCAGCGAAGGGGCGACCCCTGGACTGGAG
GCGGTGCCTCCCGTTGCTCCCCCGCCTGCGACCGCGGCCTCAGGTCCGATCCCCAAATCT
GGGCCTGAGCCTAAGAGGAGGCACCTTGGGACGCTGCTCCAGCCTACGGTCAACAAGTTC
TCCCTTCGGGTGTTCGGCAGCCACAAAGCAGTGGAAATCGAGCAGGAGCGGGTGAAGTCA
GCGGGGGCCTGGATCATCCACCCCTACAGCGACTTCCGGTTTTACTGGGACCTGATCATG
CTGCTGCTGATGGTGGGGAACCTCATCGTCCTGCCTGTGGGCATCACCTTCTTCAAGGAG
GAGAACTCCCCGCCTTGGATCGTCTTCAACGTATTGTCTGATACTTTCTTCCTACTGGAT
CTGGTGCTCAACTTCCGAACGGGCATCGTGGTGGAGGAGGGTGCTGAGATCCTGCTGGCA
CCGCGGGCCATCCGCACGCGCTACCTGCGCACCTGGTTCCTGGTTGACCTCATCTCTTCT
ATCCCTGTGGATTACATCTTCCTAGTGGTGGAGCTGGAGCCACGGTTGGACGCTGAGGTC
TACAAAACGGCACGGGCCCTACGCATCGTTCGCTTCACCAAGATCCTAAGCCTGCTGAGG
CTGCTCCGCCTCTCCCGCCTCATCCGCTACATACACCAGTGGGAGGAGATCTTTCACATG
ACCTATGACCTGGCCAGTGCTGTGGTTCGCATCTTCAACCTCATTGGGATGATGCTGCTG
CTATGTCACTGGGATGGCTGTCTGCAGTTCCTGGTGCCCATGCTGCAGGACTTCCCTCCC
GACTGCTGGGTCTCCATCAACCACATGGTGAACCACTCGTGGGGCCGCCAGTATTCCCAT
GCCCTGTTCAAGGCCATGAGCCACATGCTGTGCATTGGCTATGGGCAGCAGGCACCTGTA
GGCATGCCCGACGTCTGGCTCACCATGCTCAGCATGATCGTAGGTGCCACATGCTACGCC
ATGTTCATCGGCCATGCCACGGCACTCATCCAGTCCCTGGACTCTTCCCGGCGTCAGTAC
CAGGAGAAGTACAAGCAGGTGGAGCAGTACATGTCCTTCCACAAGCTGCCAGCAGACACG
CGGCAGCGCATCCACGAGTACTATGAGCACCGCTACCAGGGCAAGATGTTCGATGAGGAA
AGCATCCTGGGCGAGCTGAGCGAGCCGCTTCGCGAGGAGATCATTAACTTCACCTGTCGG
GGCCTGGTGGCCCACATGCCGCTGTTTGCCCATGCCGACCCCAGCTTCGTCACTGCAGTT
CTCACCAAGCTGCGCTTTGAGGTCTTCCAGCCGGGGGATCTCGTGGTGCGTGAGGGCTCC
GTGGGGAGGAAGATGTACTTCATCCAGCATGGGCTGCTCAGTGTGCTGGCCCGCGGCGCC
CGGGACACACGCCTCACCGATGGATCCTACTTTGGGGAGATCTGCCTGCTAACTAGGGGC
CGGCGCACAGCCAGTGTTCGGGCTGACACCTACTGCCGCCTTTACTCACTCAGCGTGGAC
CATTTCAATGCTGTGCTTGAGGAGTTCCCCATGATGCGCCGGGCCTTTGAGACTGTGGCC
ATGGATCGGCTGCTCCGCATCGGCAAGAAGAATTCCATACTGCAGCGGAAGCGCTCCGAG
CCAAGTCCAGGCAGCAGTGGTGGCATCATGGAGCAGCACTTGGTGCAACATGACAGAGAC
ATGGCTCGGGGTGTTCGGGGTCGGGCCCCGAGCACAGGAGCTCAGCTTAGTGGAAAGCCA
GTACTGTGGGAGCCACTGGTACATGCGCCCCTTCAGGCAGCTGCTGTGACCTCCAATGTG
GCCATTGCCCTGACTCATCAGCGGGGCCCTCTGCCCCTCTCCCCTGACTCTCCAGCCACC
CTCCTTGCTCGCTCTGCTTGGCGCTCAGCAGGCTCTCCAGCTTCCCCGCTGGTGCCCGTC
CGAGCTGGCCCATGGGCATCCACCTCCCGCCTGCCCGCCCCACCTGCCCGAACCCTGCAC
GCCAGCCTATCCCGGGCAGGGCGCTCCCAGGTCTCCCTGCTGGGTCCCCCTCCAGGAGGA
GGTGGACGGCGGCTAGGACCTCGGGGCCGCCCACTCTCAGCCTCCCAACCCTCTCTGCCT
CAGCGGGCAACAGGCGATGGCTCTCCTGGGCGTAAGGGATCAGGAAGTGAGCGGCTGCCT
CCCTCAGGGCTCCTGGCCAAACCTCCAAGGACAGCCCAGCCCCCCAGGCCACCAGTGCCT
GAGCCAGCCACACCCCGGGGTCTCCAGCTTTCTGCCAACATGTAA
Protein Properties
Number of Residues 774
Molecular Weight 86031.0
Theoretical pI 10.12
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 98-118
  • 125-145
  • 172-192
  • 202-222
  • 254-274
  • 330-350
Protein Sequence
>Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3
MEAEQRPAAGASEGATPGLEAVPPVAPPPATAASGPIPKSGPEPKRRHLGTLLQPTVNKF
SLRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFFKE
ENSPPWIVFNVLSDTFFLLDLVLNFRTGIVVEEGAEILLAPRAIRTRYLRTWFLVDLISS
IPVDYIFLVVELEPRLDAEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHM
TYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPPDCWVSINHMVNHSWGRQYSH
ALFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQY
QEKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFDEESILGELSEPLREEIINFTCR
GLVAHMPLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVLARGA
RDTRLTDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFETVA
MDRLLRIGKKNSILQRKRSEPSPGSSGGIMEQHLVQHDRDMARGVRGRAPSTGAQLSGKP
VLWEPLVHAPLQAAAVTSNVAIALTHQRGPLPLSPDSPATLLARSAWRSAGSPASPLVPV
RAGPWASTSRLPAPPARTLHASLSRAGRSQVSLLGPPPGGGGRRLGPRGRPLSASQPSLP
QRATGDGSPGRKGSGSERLPPSGLLAKPPRTAQPPRPPVPEPATPRGLQLSANM
GenBank ID Protein 38327037
UniProtKB/Swiss-Prot ID Q9P1Z3
UniProtKB/Swiss-Prot Entry Name HCN3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_020897.1
GeneCard ID HCN3
GenAtlas ID HCN3
HGNC ID HGNC:19183
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  3. Nagase T, Kikuno R, Ishikawa K, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Apr 28;7(2):143-50. [PubMed:10819331 ]