You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09061
Secondary Accession Numbers
  • 14803
Name Neurofascin
Synonyms Not Available
Gene Name NFASC
Protein Type Unknown
Biological Properties
General Function Posttranslational modification, protein turnover, chaperones
Specific Function Cell adhesion, ankyrin-binding protein which may be involved in neurite extension, axonal guidance, synaptogenesis, myelination and neuron-glial cell interactions
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Cell membrane
  2. Single-pass type I membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 1q32.1
SNPs NFASC
Gene Sequence
>3723 bp
ATGGCCAGGCAGCCACCGCCGCCCTGGGTCCATGCAGCCTTCCTCCTCTGCCTCCTCAGT
CTTGGCGGAGCCATCGAAATTCCTATGGATCCAAGCATTCAGAATGAGCTGACGCAGCCG
CCAACCATCACCAAGCAGTCAGCGAAGGATCACATCGTGGACCCCCGTGATAACATCCTG
ATTGAGTGTGAAGCAAAAGGGAACCCTGCCCCCAGCTTCCACTGGACACGAAACAGCAGA
TTCTTCAACATCGCCAAGGACCCCCGGGTGTCCATGAGGAGGAGGTCTGGGACCCTGGTG
ATTGACTTCCGCAGTGGCGGGCGGCCGGAGGAATATGAGGGGGAATATCAGTGCTTCGCC
CGCAACAAATTTGGCACGGCCCTGTCCAATAGGATCCGCCTGCAGGTGTCTAAATCTCCT
CTGTGGCCCAAGGAAAACCTAGACCCTGTCGTGGTCCAAGAGGGCGCTCCTTTGACGCTC
CAGTGCAACCCCCCGCCTGGACTTCCATCCCCGGTCATCTTCTGGATGAGCAGCTCCATG
GAGCCCATCACCCAAGACAAACGTGTCTCTCAGGGCCATAACGGAGACCTATACTTCTCC
AACGTGATGCTGCAGGACATGCAGACCGACTACAGTTGTAACGCCCGCTTCCACTTCACC
CACACCATCCAGCAGAAGAACCCTTTCACCCTCAAGGTCCTCACCACCCGAGGAGTTGCA
GAAAGAACACCAAGCTTCATGTATCCCCAGGGCACCGCGAGCAGCCAGATGGTGCTTCGT
GGCATGGACCTCCTGCTGGAATGCATCGCCTCCGGGGTCCCAACACCAGACATCGCATGG
TACAAGAAAGGTGGGGACCTCCCATCTGATAAGGCCAAGTTTGAGAACTTTAATAAGGCC
CTGCGTATCACAAATGTCTCTGAGGAAGACTCCGGGGAGTATTTCTGCCTGGCCTCCAAC
AAGATGGGCAGCATCCGGCACACGATCTCGGTGAGAGTAAAGGCTGCTCCCTACTGGCTG
GACGAACCCAAGAACCTTATTCTGGCTCCTGGCGAGGATGGGAGACTGGTGTGTCGAGCC
AATGGAAACCCCAAACCCACTGTCCAGTGGATGGTGAATGGGGAACCTTTGCAATCGGCA
CCACCTAACCCAAACCGTGAGGTGGCCGGAGACACCATCATCTTCCGGGACACCCAGATC
AGCAGCAGGGCTGTGTACCAGTGCAACACCTCCAACGAGCATGGCTACCTGCTGGCCAAC
GCCTTTGTCAGTGTGCTGGATGTGCCGCCTCGGATGCTGTCGCCCCGGAACCAGCTCATT
CGAGTGATTCTTTACAACCGGACGCGGCTGGACTGCCCTTTCTTTGGGTCTCCCATCCCC
ACACTGCGATGGTTTAAGAATGGGCAAGGAAGCAACCTGGATGGTGGCAACTACCATGTT
TATGAGAACGGCAGTCTGGAAATTAAGATGATCCGCAAAGAGGACCAGGGCATCTACACC
TGTGTCGCCACCAACATCCTGGGCAAAGCTGAAAACCAAGTCCGCCTGGAGGTCAAAGAC
CCCACCAGGATCTACCGGATGCCCGAGGACCAGGTGGCCAGAAGGGGCACCACGGTGCAG
CTGGAGTGTCGGGTGAAGCACGACCCCTCCCTGAAACTCACCGTCTCCTGGCTGAAGGAT
GACGAGCCGCTCTATATTGGAAACAGGATGAAGAAGGAAGACGACTCCCTGACCATCTTT
GGGGTGGCAGAGCGGGACCAGGGCAGTTACACGTGTGTCGCCAGCACCGAGCTAGACCAA
GACCTGGCCAAGGCCTACCTCACCGTGCTAGCTGATCAGGCCACTCCAACTAACCGTTTG
GCTGCCCTGCCCAAAGGACGGCCAGACCGGCCCCGGGACCTGGAGCTGACCGACCTGGCC
GAGAGGAGCGTGCGGCTGACCTGGATCCCCGGGGATGCTAACAACAGCCCCATCACAGAC
TACGTCGTCCAGTTTGAAGAAGACCAGTTCCAACCTGGGGTCTGGCATGACCATTCCAAG
TACCCCGGCAGCGTTAACTCAGCCGTCCTCCGGCTGTCCCCGTATGTCAACTACCAGTTC
CGTGTCATTGCCATCAACGAGGTTGGGAGCAGCCACCCCAGCCTCCCATCCGAGCGCTAC
CGAACCAGTGGAGCACCCCCCGAGTCCAATCCTGGTGACGTGAAGGGAGAGGGGACCAGA
AAGAACAACATGGAGATCACGTGGACGCCCATGAATGCCACCTCGGCCTTTGGCCCCAAC
CTGCGCTACATTGTCAAGTGGAGGCGGAGAGAGACTCGAGAGGCCTGGAACAACGTCACA
GTGTGGGGCTCTCGCTACGTGGTGGGGCAGACCCCAGTCTACGTGCCCTATGAGATCCGA
GTCCAGGCTGAAAATGACTTCGGGAAGGGCCCTGAGCCAGAGTCCGTCATCGGTTACTCC
GGAGAAGATTTACCCAGTGCCCCTAGGCGTTTCCGAGTCCGGCAGCCCAACCTGGAGACA
ATCAACCTGGAATGGGATCATCCTGAGCATCCAAATGGGATCATGATTGGATACACTCTC
AAATATGTGGCCTTTAACGGGACCAAAGTAGGAAAGCAGATAGTGGAAAACTTCTCTCCC
AATCAGACCAAGTTCACGGTGCAAAGAACGGACCCCGTGTCACGCTACCGCTTTACCCTC
AGCGCCAGGACGCAGGTGGGCTCTGGGGAAGCCGTCACAGAGGAGTCACCAGCACCCCCG
AATGAAGCTACTCCAACCGCAGCTCCTCCCACATTGCCCCCGACTACCGTGGGTGCGACG
GGCGCTGTGAGCAGTACCGATGCTACTGCCATTGCTGCCACCACCGAAGCCACAACAGTC
CCCATCATCCCAACTGTCGCACCTACCACCATCGCCACCACCACCACCGTCGCCACAACT
ACTACAACCACTGCTGCCGCCACCACCACCACGGAGAGTCCTCCCACCACCACCTCCGGG
ACTAAGATACACGAATCCGCCCCTGATGAGCAGTCCATATGGAACGTCACGGTGCTCCCC
AACAGTAAATGGGCCAACATCACCTGGAAGCACAATTTCGGGCCCGGAACTGACTTTGTG
GTTGAGTACATCGACAGCAACCATACGAAAAAAACTGTCCCAGTTAAGGCCCAGGCTCAG
CCTATACAGCTGACAGACCTCTATCCCGGGATGACATACACGTTGCGGGTTTATTCCCGG
GACAACGAGGGCATCAGCAGTACCGTCATCACCTTTATGACCAGTACAGCTTACACCAAC
AACCAAGCGGACATCGCCACCCAGGGCTGGTTCATTGGGCTTATGTGCGCCATCGCCCTC
CTGGTGCTGATCCTGCTCATCGTCTGTTTCATCAAGAGGAGTCGCGGCGGCAAGTACCCA
GTACGAGAAAAGAAGGATGTTCCCCTTGGCCCTGAAGACCCCAAGGAAGAGGATGGCTCA
TTTGACTATAGTGATGAGGACAACAAGCCCCTGCAGGGCAGTCAGACATCTCTGGACGGC
ACCATCAAGCAGCAGGAGAGTGACGACAGCCTGGTGGACTATGGCGAGGGTGGCGAGGGT
CAGTTCAATGAAGACGGCTCCTTCATCGGCCAGTACACGGTCAAAAAGGACAAGGAGGAA
ACAGAGGGCAACGAAAGCTCAGAGGCCACGTCACCTGTCAATGCTATCTACTCTCTGGCC
TAA
Protein Properties
Number of Residues 1347
Molecular Weight 150025.7
Theoretical pI 6.61
Pfam Domain Function
Signals
  • 1-24
Transmembrane Regions
  • 1218-1238
Protein Sequence
>Neurofascin
MARQPPPPWVHAAFLLCLLSLGGAIEIPMDPSIQNELTQPPTITKQSAKDHIVDPRDNIL
IECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFA
RNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSSM
EPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVA
ERTPSFMYPQGTASSQMVLRGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKA
LRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRA
NGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLAN
AFVSVLDVPPRMLSPRNQLIRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGNYHV
YENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQ
LECRVKHDPSLKLTVSWLKDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQ
DLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDANNSPITD
YVVQFEEDQFQPGVWHDHSKYPGSVNSAVLRLSPYVNYQFRVIAINEVGSSHPSLPSERY
RTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRETREAWNNVT
VWGSRYVVGQTPVYVPYEIRVQAENDFGKGPEPESVIGYSGEDYPRAAPTEVKVRVMNST
AISLQWNRVYSDTVQGQLREYRAYYWRESSLLKNLWVSQKRQQASFPGDRLRGVVSRLFP
YSNYKLEMVVVNGRGDGPRSETKEFTTPEGVPSAPRRFRVRQPNLETINLEWDHPEHPNG
IMIGYTLKYVAFNGTKVGKQIVENFSPNQTKFTVQRTDPVSRYRFTLSARTQVGSGEAVT
EESPAPPNEATPTAAPPTLPPTTVGATGAVSSTDATAIAATTEATTVPIIPTVAPTTIAT
TTTVATTTTTTAAATTTTESPPTTTSGTKIHESAPDEQSIWNVTVLPNSKWANITWKHNF
GPGTDFVVEYIDSNHTKKTVPVKAQAQPIQLTDLYPGMTYTLRVYSRDNEGISSTVITFM
TSTAYTNNQADIATQGWFIGLMCAIALLVLILLIVCFIKRSRGGKYPVREKKDVPLGPED
PKEEDGSFDYSDEDNKPLQGSQTSLDGTIKQQESDDSLVDYGEGGEGQFNEDGSFIGQYT
VKKDKEETEGNESSEATSPVNAIYSLA
GenBank ID Protein 237858675
UniProtKB/Swiss-Prot ID O94856
UniProtKB/Swiss-Prot Entry Name NFASC_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001005388
GeneCard ID NFASC
GenAtlas ID NFASC
HGNC ID HGNC:29866
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Nakajima D, Okazaki N, Yamakawa H, Kikuno R, Ohara O, Nagase T: Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones. DNA Res. 2002 Jun 30;9(3):99-106. [PubMed:12168954 ]
  6. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  7. Nagase T, Ishikawa K, Suyama M, Kikuno R, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Oct 30;5(5):277-86. [PubMed:9872452 ]
  8. Homma K, Kikuno RF, Nagase T, Ohara O, Nishikawa K: Alternative splice variants encoding unstable protein domains exist in the human brain. J Mol Biol. 2004 Nov 5;343(5):1207-20. [PubMed:15491607 ]