Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09066
Secondary Accession Numbers
  • 14808
Name Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 3
Synonyms
  1. B-ind1
  2. Butyrate-induced protein 1
  3. HACD3
  4. Protein tyrosine phosphatase-like protein PTPLAD1
  5. Protein-tyrosine phosphatase-like A domain-containing protein 1
  6. hB-ind1
  7. 3-hydroxyacyl-CoA dehydratase 3
Gene Name PTPLAD1
Protein Type Unknown
Biological Properties
General Function Involved in GTPase activator activity
Specific Function Responsible for the dehydration step in very long-chain fatty acid (VLCFA) synthesis. Involved in Rac1-signaling pathways leading to the modulation of gene expression.
Pathways Not Available
Reactions
A very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] → a very-long-chain trans-2,3-dehydroacyl-[acyl-carrier protein] + Water details
GO Classification
Biological Process
activation of JUN kinase activity
I-kappaB kinase/NF-kappaB cascade
Rac protein signal transduction
Rho protein signal transduction
fatty acid biosynthetic process
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Molecular Function
GTPase activator activity
lyase activity
Cellular Location
  1. Endoplasmic reticulum membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location 15
Locus 15q22.2
SNPs PTPLAD1
Gene Sequence
>1089 bp
ATGGAGAATCAGGTGTTGACGCCGCATGTCTACTGGGCTCAGCGACACCGCGAGCTATAT
CTGCGCGTGGAGCTGAGTGACGTACAGAACCCTGCCATCAGCATCACTGAAAACGTGCTG
CATTTCAAAGCTCAAGGACATGGTGCCAAAGGAGACAATGTCTATGAATTTCACCTGGAG
TTCTTAGACCTTGTGAAACCAGAGCCTGTTTACAAACTGACCCAGAGGCAGGTAAACATT
ACAGTACAGAAGAAAGTGAGTCAGTGGTGGGAGAGACTCACAAAGCAGGAAAAGCGACCA
CTGTTTTTGGCTCCTGACTTTGATCGTTGGCTGGATGAATCTGATGCGGAAATGGAGCTC
AGAGCTAAGGAAGAAGAGCGCCTAAATAAACTCCGACTGGAAAGCGAAGGCTCTCCTGAA
ACTCTTACAAACTTAAGGAAAGGATACCTGTTTATGTATAATCTTGTGCAATTCTTGGGA
TTCTCCTGGATCTTTGTCAACCTGACTGTGCGATTCTGTATCTTGGGAAAAGAGTCCTTT
TATGACACATTCCATACTGTGGCTGACATGATGTATTTCTGCCAGATGCTGGCAGTTGTG
GAAACTATCAATGCAGCAATTGGAGTCACTACGTCACCGGTGCTGCCTTCTCTGATCCAG
CTTCTTGGAAGAAATTTTATTTTGTTTATCATCTTTGGCACCATGGAAGAAATGCAGAAC
AAAGCTGTGGTTTTCTTTGTGTTTTATTTGTGGAGTGCAATTGAAATTTTCAGGTACTCT
TTCTACATGCTGACGTGCATTGACATGGATTGGAAGGTGCTCACATGGCTTCGTTACACT
CTGTGGATTCCCTTATATCCACTGGGATGTTTGGCGGAAGCTGTCTCAGTGATTCAGTCC
ATTCCAATATTCAATGAGACCGGACGATTCAGTTTCACATTGCCATATCCAGTGAAAATC
AAAGTTAGATTTTCCTTTTTTCTTCAGATTTATCTTATAATGATATTTTTAGGTTTATAC
ATAAATTTTCGTCACCTTTATAAACAGCGCAGACGGCGCTATGGACAAAAAAAGAAAAAG
ATCCACTAA
Protein Properties
Number of Residues 362
Molecular Weight 43159.225
Theoretical pI 8.946
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>3-hydroxyacyl-CoA dehydratase 3
MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLE
FLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL
RAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKESF
YDTFHTVADMMYFCQMLAVVETINAAIGVTTSPVLPSLIQLLGRNFILFIIFGTMEEMQN
KAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWKVLTWLRYTLWIPLYPLGCLAEAVSVIQS
IPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQRRRRYGQKKKK
IH
GenBank ID Protein 117168248
UniProtKB/Swiss-Prot ID Q9P035
UniProtKB/Swiss-Prot Entry Name HACD3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_016395.2
GeneCard ID PTPLAD1
GenAtlas ID PTPLAD1
HGNC ID HGNC:24175
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [PubMed:19369195 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  8. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  9. Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd: Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis. J Proteome Res. 2008 Mar;7(3):1346-51. doi: 10.1021/pr0705441. Epub 2008 Jan 26. [PubMed:18220336 ]
  10. Zhang QH, Ye M, Wu XY, Ren SX, Zhao M, Zhao CJ, Fu G, Shen Y, Fan HY, Lu G, Zhong M, Xu XR, Han ZG, Zhang JW, Tao J, Huang QH, Zhou J, Hu GX, Gu J, Chen SJ, Chen Z: Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells. Genome Res. 2000 Oct;10(10):1546-60. [PubMed:11042152 ]
  11. Han G, Ye M, Zhou H, Jiang X, Feng S, Jiang X, Tian R, Wan D, Zou H, Gu J: Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography. Proteomics. 2008 Apr;8(7):1346-61. doi: 10.1002/pmic.200700884. [PubMed:18318008 ]
  12. Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R: Phosphoproteome analysis of the human mitotic spindle. Proc Natl Acad Sci U S A. 2006 Apr 4;103(14):5391-6. Epub 2006 Mar 24. [PubMed:16565220 ]
  13. Courilleau D, Chastre E, Sabbah M, Redeuilh G, Atfi A, Mester J: B-ind1, a novel mediator of Rac1 signaling cloned from sodium butyrate-treated fibroblasts. J Biol Chem. 2000 Jun 9;275(23):17344-8. [PubMed:10747961 ]
  14. Sabbah M, Saucier C, Redeuilh G: Human B-ind1 gene promoter: cloning and regulation by histone deacetylase inhibitors. Gene. 2006 Jun 7;374:128-33. Epub 2006 Mar 3. [PubMed:16516406 ]
  15. Liu Y, Gao L, Gelman IH: SSeCKS/Gravin/AKAP12 attenuates expression of proliferative and angiogenic genes during suppression of v-Src-induced oncogenesis. BMC Cancer. 2006 Apr 25;6:105. [PubMed:16638134 ]
  16. Ikeda M, Kanao Y, Yamanaka M, Sakuraba H, Mizutani Y, Igarashi Y, Kihara A: Characterization of four mammalian 3-hydroxyacyl-CoA dehydratases involved in very long-chain fatty acid synthesis. FEBS Lett. 2008 Jul 9;582(16):2435-40. doi: 10.1016/j.febslet.2008.06.007. Epub 2008 Jun 11. [PubMed:18554506 ]