Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09076
Secondary Accession Numbers
  • 14820
Name Sodium-dependent neutral amino acid transporter B(0)AT3
Synonyms
  1. Sodium- and chloride-dependent transporter XTRP2
  2. Solute carrier family 6 member 18
  3. System B(0) neutral amino acid transporter AT3
Gene Name SLC6A18
Protein Type Unknown
Biological Properties
General Function Involved in neurotransmitter:sodium symporter activity
Specific Function Functions as a sodium and chloride-dependent neutral amino acid transporter (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
amino acid transport
response to osmotic stress
transmembrane transport
Cellular Component
plasma membrane
integral to plasma membrane
Component
integral to plasma membrane
membrane
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
neurotransmitter transporter activity
neurotransmitter:sodium symporter activity
transmembrane transporter activity
transporter activity
Molecular Function
neurotransmitter:sodium symporter activity
Process
establishment of localization
transport
neurotransmitter transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Probable)
Gene Properties
Chromosome Location 5
Locus 5p15.33
SNPs SLC6A18
Gene Sequence
>1887 bp
ATGGCTCATGCCCCAGAACCGGACCCGGCCGCCTGCGACCTCGGGGATGAGAGGCCCAAG
TGGGACAACAAGGCCCAGTACCTCCTGAGCTGCATTGGGTTTGCCGTGGGGCTGGGGAAC
ATTTGGCGGTTCCCATACCTGTGCCAGACCTATGGAGGAGGGGCCTTCCTCATCCCCTAC
GTCATCGCGCTGGTCTTCGAGGGGATCCCCATTTTCCACGTCGAGCTCGCCATCGGCCAG
CGGCTGCGGAAGGGCAGCGTCGGCGTGTGGACGGCCATCTCCCCGTACCTCAGTGGAGTA
GGGCTGGGCTGTGTCACGCTGTCCTTCCTGATCAGCCTGTACTACAACACCATCGTGGCG
TGGGTGCTGTGGTACCTCCTCAACTCCTTCCAGCACCCGCTGCCCTGGAGCTCCTGCCCA
CCGGACCTCAACAGAACAGGGTTTGTGGAGGAGTGCCAGGGCAGCAGCGCCGTGAGCTAC
TTCTGGTACCGGCAGACACTGAACATCACAGCCGACATCAATGACAGTGGCTCCATCCAG
TGGTGGCTGCTCATCTGCTTGGCAGCCTCCTGGGCAGTCGTGTACATGTGTGTCATCAGG
GGCATTGAGACTACAGGGAAGGTGATTTACTTCACAGCTTTGTTCCCTTACCTGGTCCTG
ACCATCTTTCTCATCAGAGGGCTGACCCTGCCAGGGGCAACAAAAGGACTCATCTACTTG
TTCACTCCCAACATGCACATTCTCCAGAACCCCCGGGTGTGGCTGGACGCAGCCACCCAG
ATATTCTTCTCTCTGTCCCTGGCCTTCGGAGGACACATCGCTTTTGCAAGTTACAACTCG
CCCAGGAATGACTGCCAGAAGGATGCGGTGGTCATCGCCCTGGTCAACAGGATGACCTCC
CTGTACGCGTCCATCGCTGTCTTCTCTGTCCTGGGGTTCAAAGCAACTAATGACTACGAG
CACTGCCTGGACAGAAACATCCTCAGCCTCATCAACGACTTTGACTTCCCAGAGCAGAGC
ATCTCCAGGGACGACTACCCAGCCGTCCTCATGCACCTGAACGCCACCTGGCCCAAGAGG
GTGGCCCAGCTCCCCCTGAAGGCCTGCCTCCTGGAAGACTTTCTGGATAAGAGTGCCTCG
GGCCCGGGCCTGGCCTTCGTCGTCTTCACGGAGACCGACCTCCACATGCCGGGGGCTCCT
GTGTGGGCCATGCTCTTCTTCGGGATGCTGTTCACCTTGGGGCTATCGACCATGTTCGGG
ACCGTGGAGGCGGTCATCACACCCCTGCTGGACGTGGGGGTCCTGCCTAGATGGGTCCCC
AAGGAGGCCCTGACTGGGCTGGTCTGCCTGGTCTGCTTCCTCTCCGCCACCTGCTTCACG
CTGCAGTCTGGGAACTACTGGCTGGAGATTTTCGACAATTTTGCCGCTTCCCTGAACCTG
CTCATGTTGGCCTTTCTCGAGGTTGTGGGTGTCGTTTATGTTTATGGAATGAAACGGTTC
TGCGATGACATTGCGTGGATGACCGGGAGGCGGCCCAGCCCCTACTGGCGGCTGACCTGG
AGGGTGGTCAGTCCCCTGCTGCTGACCATCTTTGTGGCTTACATCATCCTCCTGTTCTGG
AAGCCACTGAGATACAAGGCCTGGAACCCCAAATACGAGCTGTTCCCCTCGCGTCAGGAG
AAGCTCTACCCGGGCTGGGCGCGCGCCGCCTGTGTGCTGCTGTCCTTGCTGCCCGTGCTG
TGGGTCCCGGTGGCCGCGCTTGCTCAGCTGCTCACCCGGCGGAGGCGGACGTGGAGGGAC
AGGGACGCGCGCCCAGACACGGACATGCGCCCGGACACGGACACGCGCCCAGACACGGAC
ATGCGCCCGGACACGGACATGCGCTGA
Protein Properties
Number of Residues 628
Molecular Weight 70896.005
Theoretical pI 7.291
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Sodium-dependent neutral amino acid transporter B(0)AT3
MAHAPEPDPAACDLGDERPKWDNKAQYLLSCIGFAVGLGNIWRFPYLCQTYGGGAFLIPY
VIALVFEGIPIFHVELAIGQRLRKGSVGVWTAISPYLSGVGLGCVTLSFLISLYYNTIVA
WVLWYLLNSFQHPLPWSSCPPDLNRTGFVEECQGSSAVSYFWYRQTLNITADINDSGSIQ
WWLLICLAASWAVVYMCVIRGIETTGKVIYFTALFPYLVLTIFLIRGLTLPGATKGLIYL
FTPNMHILQNPRVWLDAATQIFFSLSLAFGGHIAFASYNSPRNDCQKDAVVIALVNRMTS
LYASIAVFSVLGFKATNDYEHCLDRNILSLINDFDFPEQSISRDDYPAVLMHLNATWPKR
VAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAPVWAMLFFGMLFTLGLSTMFG
TVEAVITPLLDVGVLPRWVPKEALTGLVCLVCFLSATCFTLQSGNYWLEIFDNFAASLNL
LMLAFLEVVGVVYVYGMKRFCDDIAWMTGRRPSPYWRLTWRVVSPLLLTIFVAYIILLFW
KPLRYKAWNPKYELFPSRQEKLYPGWARAACVLLSLLPVLWVPVAALAQLLTRRRRTWRD
RDARPDTDMRPDTDTRPDTDMRPDTDMR
GenBank ID Protein 16550619
UniProtKB/Swiss-Prot ID Q96N87
UniProtKB/Swiss-Prot Entry Name S6A18_HUMAN
PDB IDs Not Available
GenBank Gene ID AK055798
GeneCard ID SLC6A18
GenAtlas ID SLC6A18
HGNC ID HGNC:26441
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Kleta R, Romeo E, Ristic Z, Ohura T, Stuart C, Arcos-Burgos M, Dave MH, Wagner CA, Camargo SR, Inoue S, Matsuura N, Helip-Wooley A, Bockenhauer D, Warth R, Bernardini I, Visser G, Eggermann T, Lee P, Chairoungdua A, Jutabha P, Babu E, Nilwarangkoon S, Anzai N, Kanai Y, Verrey F, Gahl WA, Koizumi A: Mutations in SLC6A19, encoding B0AT1, cause Hartnup disorder. Nat Genet. 2004 Sep;36(9):999-1002. Epub 2004 Aug 1. [PubMed:15286787 ]
  4. Eslami B, Kinboshi M, Inoue S, Harada K, Inoue K, Koizumi A: A nonsense polymorphism (Y319X) of the solute carrier family 6 member 18 (SLC6A18) gene is not associated with hypertension and blood pressure in Japanese. Tohoku J Exp Med. 2006 Jan;208(1):25-31. [PubMed:16340170 ]