Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09082
Secondary Accession Numbers
  • 14826
Name Sodium channel protein type 3 subunit alpha
Synonyms
  1. Sodium channel protein brain III subunit alpha
  2. Sodium channel protein type III subunit alpha
  3. Voltage-gated sodium channel subtype III
  4. Voltage-gated sodium channel subunit alpha Nav1.3
Gene Name SCN3A
Protein Type Unknown
Biological Properties
General Function Involved in ion channel activity
Specific Function Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
ion channel complex
cation channel complex
macromolecular complex
protein complex
sodium channel complex
voltage-gated sodium channel complex
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
sodium channel activity
transporter activity
ion channel activity
voltage-gated sodium channel activity
cation channel activity
Process
sodium ion transport
establishment of localization
transport
transmembrane transport
monovalent inorganic cation transport
ion transport
cation transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein
Gene Properties
Chromosome Location Chromosome:2
Locus 2q24
SNPs SCN3A
Gene Sequence
>6003 bp
ATGGCACAGGCACTGTTGGTACCCCCAGGACCTGAAAGCTTCCGCCTTTTTACTAGAGAA
TCTCTTGCTGCTATCGAAAAACGTGCTGCAGAAGAGAAAGCCAAGAAGCCCAAAAAGGAA
CAAGATAATGATGATGAGAACAAACCAAAGCCAAATAGTGACTTGGAAGCTGGAAAGAAC
CTTCCATTTATTTATGGAGACATTCCTCCAGAGATGGTGTCAGAGCCCCTGGAGGACCTG
GATCCCTACTATATCAATAAGAAAACTTTTATAGTAATGAATAAAGGAAAGGCAATTTTC
CGATTCAGTGCCACCTCTGCCTTGTATATTTTAACTCCACTAAACCCTGTTAGGAAAATT
GCTATCAAGATTTTGGTACATTCTTTATTCAGCATGCTTATCATGTGCACTATTTTGACC
AACTGTGTATTTATGACCTTGAGCAACCCTCCTGACTGGACAAAGAATGTAGAGTACACA
TTCACTGGAATCTATACCTTTGAGTCACTTATAAAAATCTTGGCAAGAGGGTTTTGCTTA
GAAGATTTTACGTTTCTTCGTGATCCATGGAACTGGCTGGATTTCAGTGTCATTGTGATG
GCATATGTGACAGAGTTTGTGGACCTGGGCAATGTCTCAGCGTTGAGAACATTCAGAGTT
CTCCGAGCACTGAAAACAATTTCAGTCATTCCAGGTTTAAAGACCATTGTGGGGGCCCTG
ATCCAGTCGGTAAAGAAGCTTTCTGATGTGATGATCCTGACTGTGTTCTGTCTGAGCGTG
TTTGCTCTCATTGGGCTGCAGCTGTTCATGGGCAATCTGAGGAATAAATGTTTGCAGTGG
CCCCCAAGCGATTCTGCTTTTGAAACCAACACCACTTCCTACTTTAATGGCACAATGGAT
TCAAATGGGACATTTGTTAATGTAACAATGAGCACATTTAACTGGAAGGATTACATTGGA
GATGACAGTCACTTTTATGTTTTGGATGGGCAAAAAGACCCTTTACTCTGTGGAAATGGC
TCAGATGCAGGCCAGTGTCCAGAAGGATACATCTGTGTGAAGGCTGGTCGAAACCCCAAC
TATGGCTACACAAGCTTTGACACCTTTAGCTGGGCTTTCCTGTCTCTATTTCGACTCATG
ACTCAAGACTACTGGGAAAATCTTTACCAGTTGACATTACGTGCTGCTGGGAAAACATAC
ATGATATTTTTTGTCCTGGTCATTTTCTTGGGCTCATTTTATTTGGTGAATTTGATCCTG
GCTGTGGTGGCCATGGCCTATGAGGAGCAGAATCAGGCCACCTTGGAAGAAGCAGAACAA
AAAGAGGCCGAATTTCAGCAGATGCTCGAACAGCTTAAAAAGCAACAGGAAGAAGCTCAG
GCAGTTGCGGCAGCATCAGCTGCTTCAAGAGATTTCAGTGGAATAGGTGGGTTAGGAGAG
CTGTTGGAAAGTTCTTCAGAAGCATCAAAGTTGAGTTCCAAAAGTGCTAAAGAATGGAGG
AACCGAAGGAAGAAAAGAAGACAGAGAGAGCACCTTGAAGGAAACAACAAAGGAGAGAGA
GACAGCTTTCCCAAATCCGAATCTGAAGACAGCGTCAAAAGAAGCAGCTTCCTTTTCTCC
ATGGATGGAAACAGACTGACCAGTGACAAAAAATTCTGCTCCCCTCATCAGTCTCTCTTG
AGTATCCGTGGCTCCCTGTTTTCCCCAAGACGCAATAGCAAAACAAGCATTTTCAGTTTC
AGAGGTCGGGCAAAGGATGTTGGATCTGAAAATGACTTTGCTGATGATGAACACAGCACA
TTTGAAGACAGCGAAAGCAGGAGAGACTCACTGTTTGTGCCGCACAGACATGGAGAGCGA
CGCAACAGTAACGTTAGTCAGGCCAGTATGTCATCCAGGATGGTGCCAGGGCTTCCAGCA
AATGGGAAGATGCACAGCACTGTGGATTGCAATGGTGTGGTTTCCTTGGTGGGTGGACCT
TCAGCTCTAACGTCACCTACTGGACAACTTCCCCCAGAGGGCACCACCACAGAAACGGAA
GTCAGAAAGAGAAGGTTAAGCTCTTACCAGATTTCAATGGAGATGCTGGAGGATTCCTCT
GGAAGGCAAAGAGCCGTGAGCATAGCCAGCATTCTGACCAACACAATGGAAGAACTTGAA
GAATCTAGACAGAAATGTCCGCCATGCTGGTATAGATTTGCCAATGTGTTCTTGATCTGG
GACTGCTGTGATGCATGGTTAAAAGTAAAACATCTTGTGAATTTAATTGTTATGGATCCA
TTTGTTGATCTTGCCATCACTATTTGCATTGTCTTAAATACCCTCTTTATGGCCATGGAG
CACTACCCCATGACTGAGCAATTCAGTAGTGTGTTGACTGTAGGAAACCTGGTCTTTACT
GGGATTTTCACAGCAGAAATGGTTCTCAAGATCATTGCCATGGATCCTTATTACTATTTC
CAAGAAGGCTGGAATATCTTTGATGGAATTATTGTCAGCCTCAGTTTAATGGAGCTTGGT
CTGTCAAATGTGGAGGGATTGTCTGTACTGCGATCATTCAGACTGCTTAGAGTTTTCAAG
TTGGCAAAATCCTGGCCCACACTAAATATGCTAATTAAGATCATTGGCAATTCTGTGGGG
GCTCTAGGAAACCTCACCTTGGTGTTGGCCATCATCGTCTTCATTTTTGCTGTGGTCGGC
ATGCAGCTCTTTGGTAAGAGCTACAAAGAATGTGTCTGCAAGATCAATGATGACTGTACG
CTCCCACGGTGGCACATGAACGACTTCTTCCACTCCTTCCTGATTGTGTTCCGCGTGCTG
TGTGGAGAGTGGATAGAGACCATGTGGGACTGTATGGAGGTCGCTGGCCAAACCATGTGC
CTTATTGTTTTCATGTTGGTCATGGTCATTGGAAACCTTGTGGTTCTGAACCTCTTTCTG
GCCTTATTGTTGAGTTCATTTAGCTCAGACAACCTTGCTGCTACTGATGATGACAATGAA
ATGAATAATCTGCAGATTGCAGTAGGAAGAATGCAAAAGGGAATTGATTATGTGAAAAAT
AAGATGCGGGAGTGTTTCCAAAAAGCCTTTTTTAGAAAGCCAAAAGTTATAGAAATCCAT
GAAGGCAATAAGATAGACAGCTGCATGTCCAATAATACTGGAATTGAAATAAGCAAAGAG
CTTAATTATCTTAGAGATGGGAATGGAACCACCAGTGGTGTAGGTACTGGAAGCAGTGTT
GAAAAATACGTAATCGATGAAAATGATTATATGTCATTCATAAACAACCCCAGCCTCACC
GTCACAGTGCCAATTGCTGTTGGAGAGTCTGACTTTGAAAACTTAAATACTGAAGAGTTC
AGCAGTGAGTCAGAACTAGAAGAAAGCAAAGAGAAATTAAATGCAACCAGCTCATCTGAA
GGAAGCACAGTTGATGTTGTTCTACCCCGAGAAGGTGAACAAGCTGAAACTGAACCCGAA
GAAGACCTTAAACCGGAAGCTTGTTTTACTGAAGGATGTATTAAAAAGTTTCCATTCTGT
CAAGTAAGTACAGAAGAAGGCAAAGGGAAGATCTGGTGGAATCTTCGAAAAACCTGCTAC
AGTATTGTTGAGCACAACTGGTTTGAGACTTTCATTGTGTTCATGATCCTTCTCAGTAGT
GGTGCATTGGCCTTTGAAGATATATACATTGAACAGCGAAAGACTATCAAAACCATGCTA
GAATATGCTGACAAAGTCTTTACCTATATATTCATTCTGGAAATGCTTCTCAAATGGGTT
GCTTATGGATTTCAAACATATTTCACTAATGCCTGGTGCTGGCTAGATTTCTTGATCGTT
GATGTTTCTTTGGTTAGCCTGGTAGCCAATGCTCTTGGCTACTCAGAACTCGGTGCCATC
AAATCATTACGGACATTAAGAGCTTTAAGACCTCTAAGAGCCTTATCCCGGTTTGAAGGC
ATGAGGGTGGTTGTGAATGCTCTTGTTGGAGCAATTCCCTCTATCATGAATGTGCTGTTG
GTCTGTCTCATCTTCTGGTTGATCTTTAGCATCATGGGTGTGAATTTGTTTGCTGGCAAG
TTCTACCACTGTGTTAACATGACAACGGGTAACATGTTTGACATTAGTGATGTTAACAAT
TTGAGTGACTGTCAGGCTCTTGGCAAGCAAGCTCGGTGGAAAAACGTGAAAGTAAACTTT
GATAATGTTGGCGCTGGCTATCTTGCACTGCTTCAAGTGGCCACATTTAAAGGCTGGATG
GATATTATGTATGCAGCTGTTGATTCACGAGATGTTAAACTTCAGCCTGTATATGAAGAA
AATCTGTACATGTATTTATACTTTGTCATCTTTATCATCTTTGGGTCATTCTTCACTCTG
AATCTATTCATTGGTGTCATCATAGATAACTTCAACCAGCAGAAAAAGAAGTTTGGAGGT
CAAGACATCTTTATGACAGAGGAACAGAAAAAATATTACAATGCAATGAAGAAACTTGGA
TCCAAGAAACCTCAGAAACCCATACCTCGCCCAGCAAACAAATTCCAAGGAATGGTCTTT
GATTTTGTAACCAGACAAGTCTTTGATATCAGCATCATGATCCTCATCTGCCTCAACATG
GTCACCATGATGGTGGAAACGGATGACCAGGGCAAATACATGACCCTAGTTTTGTCCCGG
ATCAACCTAGTGTTCATTGTTCTGTTCACTGGAGAATTTGTGCTGAAGCTCGTCTCCCTC
AGACACTACTACTTCACTATAGGCTGGAACATCTTTGACTTTGTGGTGGTGATTCTCTCC
ATTGTAGGTATGTTTCTGGCTGAGATGATAGAAAAGTATTTTGTGTCCCCTACCTTGTTC
CGAGTGATCCGTCTTGCCAGGATTGGCCGAATCCTACGTCTGATCAAAGGAGCAAAGGGG
ATCCGCACGCTGCTCTTTGCTTTGATGATGTCCCTTCCTGCGTTGTTTAACATCGGCCTC
CTGCTCTTCCTGGTCATGTTTATCTATGCCATCTTTGGGATGTCCAACTTTGCCTATGTT
AAAAAGGAAGCTGGAATTGATGACATGTTCAACTTTGAGACCTTTGGCAACAGCATGATC
TGCTTGTTCCAAATTACAACCTCTGCTGGCTGGGATGGATTGCTAGCACCTATTCTTAAT
AGTGCACCACCCGACTGTGACCCTGACACAATTCACCCTGGCAGCTCAGTTAAGGGAGAC
TGTGGGAACCCATCTGTTGGGATTTTCTTTTTTGTCAGTTACATCATCATATCCTTCCTG
GTTGTGGTGAACATGTACATCGCGGTCATCCTGGAGAACTTCAGTGTTGCTACTGAAGAA
AGTGCAGAGCCCCTGAGTGAGGATGACTTTGAGATGTTCTATGAGGTTTGGGAAAAGTTT
GATCCCGATGCGACCCAGTTTATAGAGTTCTCTAAACTCTCTGATTTTGCAGCTGCCCTG
GATCCTCCTCTTCTCATAGCAAAACCCAACAAAGTCCAGCTTATTGCCATGGATCTGCCC
ATGGTCAGTGGTGACCGGATCCACTGTCTTGATATTTTATTTGCCTTTACAAAGCGTGTT
TTGGGTGAGAGTGGAGAGATGGATGCCCTTCGAATACAGATGGAAGACAGGTTTATGGCA
TCAAACCCCTCCAAAGTCTCTTATGAGCCTATTACAACCACTTTGAAACGTAAACAAGAG
GAGGTGTCTGCCGCTATCATTCAGCGTAATTTCAGATGTTATCTTTTAAAGCAAAGGTTA
AAAAATATATCAAGTAACTATAACAAAGAGGCAATTAAAGGGAGGATTGACTTACCTATA
AAACAAGACATGATTATTGACAAACTAAATGGGAACTCCACTCCAGAAAAAACAGATGGG
AGTTCCTCTACCACCTCTCCTCCTTCCTATGATAGTGTAACAAAACCAGACAAGGAAAAG
TTTGAGAAAGACAAACCAGAAAAAGAAAGCAAAGGAAAAGAGGTCAGAGAAAATCAAAAG
TAA
Protein Properties
Number of Residues 2000
Molecular Weight 226291.9
Theoretical pI 5.49
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 124-147
  • 156-175
  • 189-207
  • 214-233
  • 249-273
  • 401-426
  • 755-779
  • 791-814
  • 823-842
  • 849-869
  • 885-905
  • 959-984
  • 1202-1225
  • 1239-1264
  • 1271-1292
  • 1297-1318
  • 1338-1359
  • 1442-1468
  • 1522-1545
  • 1557-1580
  • 1587-1610
  • 1621-1642
  • 1658-1680
  • 1747-1771
Protein Sequence
>Sodium channel protein type 3 subunit alpha
MAQALLVPPGPESFRLFTRESLAAIEKRAAEEKAKKPKKEQDNDDENKPKPNSDLEAGKN
LPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVMNKGKAIFRFSATSALYILTPLNPVRKI
AIKILVHSLFSMLIMCTILTNCVFMTLSNPPDWTKNVEYTFTGIYTFESLIKILARGFCL
EDFTFLRDPWNWLDFSVIVMAYVTEFVSLGNVSALRTFRVLRALKTISVIPGLKTIVGAL
IQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPSDSAFETNTTSYFNGTMD
SNGTFVNVTMSTFNWKDYIGDDSHFYVLDGQKDPLLCGNGSDAGQCPEGYICVKAGRNPN
YGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLIL
AVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAVAAASAASRDFSGIGGLGE
LLESSSEASKLSSKSAKEWRNRRKKRRQREHLEGNNKGERDSFPKSESEDSVKRSSFLFS
MDGNRLTSDKKFCSPHQSLLSIRGSLFSPRRNSKTSIFSFRGRAKDVGSENDFADDEHST
FEDSESRRDSLFVPHRHGERRNSNVSQASMSSRMVPGLPANGKMHSTVDCNGVVSLVGGP
SALTSPTGQLPPEGTTTETEVRKRRLSSYQISMEMLEDSSGRQRAVSIASILTNTMEELE
ESRQKCPPCWYRFANVFLIWDCCDAWLKVKHLVNLIVMDPFVDLAITICIVLNTLFMAME
HYPMTEQFSSVLTVGNLVFTGIFTAEMVLKIIAMDPYYYFQEGWNIFDGIIVSLSLMELG
LSNVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVG
MQLFGKSYKECVCKINDDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQTMC
LIVFMLVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVGRMQKGIDYVKN
KMRECFQKAFFRKPKVIEIHEGNKIDSCMSNNTGIEISKELNYLRDGNGTTSGVGTGSSV
EKYVIDENDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESELEESKEKLNATSSSE
GSTVDVVLPREGEQAETEPEEDLKPEACFTEGCIKKFPFCQVSTEEGKGKIWWNLRKTCY
SIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFTYIFILEMLLKWV
AYGFQTYFTNAWCWLDFLIVDVSLVSLVANALGYSELGAIKSLRTLRALRPLRALSRFEG
MRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNMTTGNMFDISDVNN
LSDCQALGKQARWKNVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRDVKLQPVYEE
NLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLG
SKKPQKPIPRPANKFQGMVFDFVTRQVFDISIMILICLNMVTMMVETDDQGKYMTLVLSR
INLVFIVLFTGEFVLKLVSLRHYYFTIGWNIFDFVVVILSIVGMFLAEMIEKYFVSPTLF
RVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYV
KKEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSAPPDCDPDTIHPGSSVKGD
CGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKF
DPDATQFIEFSKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRV
LGESGEMDALRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQRNFRCYLLKQRL
KNISSNYNKEAIKGRIDLPIKQDMIIDKLNGNSTPEKTDGSSSTTSPPSYDSVTKPDKEK
FEKDKPEKESKGKEVRENQK
GenBank ID Protein 126362949
UniProtKB/Swiss-Prot ID Q9NY46
UniProtKB/Swiss-Prot Entry Name SCN3A_HUMAN
PDB IDs
GenBank Gene ID NM_006922.3
GeneCard ID SCN3A
GenAtlas ID SCN3A
HGNC ID HGNC:10590
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Nagase T, Kikuno R, Ishikawa KI, Hirosawa M, Ohara O: Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 2000 Feb 28;7(1):65-73. [PubMed:10718198 ]
  3. Rougier JS, van Bemmelen MX, Bruce MC, Jespersen T, Gavillet B, Apotheloz F, Cordonier S, Staub O, Rotin D, Abriel H: Molecular determinants of voltage-gated sodium channel regulation by the Nedd4/Nedd4-like proteins. Am J Physiol Cell Physiol. 2005 Mar;288(3):C692-701. Epub 2004 Nov 17. [PubMed:15548568 ]
  4. Weiss LA, Escayg A, Kearney JA, Trudeau M, MacDonald BT, Mori M, Reichert J, Buxbaum JD, Meisler MH: Sodium channels SCN1A, SCN2A and SCN3A in familial autism. Mol Psychiatry. 2003 Feb;8(2):186-94. [PubMed:12610651 ]
  5. Kasai N, Fukushima K, Ueki Y, Prasad S, Nosakowski J, Sugata K, Sugata A, Nishizaki K, Meyer NC, Smith RJ: Genomic structures of SCN2A and SCN3A - candidate genes for deafness at the DFNA16 locus. Gene. 2001 Feb 7;264(1):113-22. [PubMed:11245985 ]
  6. Lu CM, Brown GB: Isolation of a human-brain sodium-channel gene encoding two isoforms of the subtype III alpha-subunit. J Mol Neurosci. 1998 Feb;10(1):67-70. [PubMed:9589372 ]
  7. Malo MS, Srivastava K, Andresen JM, Chen XN, Korenberg JR, Ingram VM: Targeted gene walking by low stringency polymerase chain reaction: assignment of a putative human brain sodium channel gene (SCN3A) to chromosome 2q24-31. Proc Natl Acad Sci U S A. 1994 Apr 12;91(8):2975-9. [PubMed:8159690 ]