Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09085
Secondary Accession Numbers
  • 14829
Name Sodium channel subunit beta-4
Synonyms Not Available
Gene Name SCN4B
Protein Type Unknown
Biological Properties
General Function Involved in voltage-gated sodium channel activity
Specific Function Modulates channel gating kinetics. Causes negative shifts in the voltage dependence of activation of certain alpha sodium channels, but does not affect the voltage dependence of inactivation
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location
  1. Membrane
  2. Single-pass type I membrane protein (Probable)
Gene Properties
Chromosome Location Chromosome:1
Locus 11q23.3
SNPs SCN4B
Gene Sequence
>687 bp
ATGCCCGGGGCTGGGGACGGAGGCAAAGCCCCGGCGAGATGGCTGGGCACTGGGCTTTTG
GGCCTCTTCCTGCTCCCCGTAACCCTGTCGCTGGAGGTGTCTGTGGGAAAGGCCACCGAC
ATCTACGCTGTCAATGGCACGGAGATCCTGCTGCCCTGCACCTTCTCCAGCTGCTTTGGC
TTCGAGGACCTCCACTTCCGGTGGACCTACAACAGCAGTGACGCATTCAAGATTCTCATA
GAGGGGACTGTGAAGAATGAGAAGTCTGACCCCAAGGTGACGTTGAAAGACGATGACCGC
ATCACTCTGGTAGGCTCTACTAAGGAGAAGATGAACAACATTTCCATTGTGCTGAGGGAC
CTGGAGTTCAGCGACACGGGCAAATACACCTGCCATGTGAAGAACCCCAAGGAGAATAAT
CTCCAGCACCACGCCACCATCTTCCTCCAAGTCGTTGATAGACTGGAAGAAGTGGACAAC
ACAGTGACACTCATCATCCTGGCTGTCGTGGGCGGGGTCATCGGGCTCCTCATCCTCATC
CTGCTGATCAAGAAACTCATCATCTTCATCCTGAAGAAGACTCGGGAGAAGAAGAAGGAG
TGTCTCGTGAGCTCCTCGGGGAATGACAACACGGAGAACGGCTTGCCTGGCTCCAAGGCA
GAGGAGAAACCACCTTCAAAAGTGTGA
Protein Properties
Number of Residues 228
Molecular Weight 24968.8
Theoretical pI 7.45
Pfam Domain Function
Signals
  • 1-30
Transmembrane Regions
  • 163-183
Protein Sequence
>Sodium channel subunit beta-4
MPGAGDGGKAPARWLGTGLLGLFLLPVTLSLEVSVGKATDIYAVNGTEILLPCTFSSCFG
FEDLHFRWTYNSSDAFKILIEGTVKNEKSDPKVTLKDDDRITLVGSTKEKMNNISIVLRD
LEFSDTGKYTCHVKNPKENNLQHHATIFLQVVDRLEEVDNTVTLIILAVVGGVIGLLILI
LLIKKLIIFILKKTREKKKECLVSSSGNDNTENGLPGSKAEEKPPSKV
GenBank ID Protein 27465047
UniProtKB/Swiss-Prot ID Q8IWT1
UniProtKB/Swiss-Prot Entry Name SCN4B_HUMAN
PDB IDs Not Available
GenBank Gene ID AY149967
GeneCard ID SCN4B
GenAtlas ID SCN4B
HGNC ID HGNC:10592
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Yu FH, Westenbroek RE, Silos-Santiago I, McCormick KA, Lawson D, Ge P, Ferriera H, Lilly J, DiStefano PS, Catterall WA, Scheuer T, Curtis R: Sodium channel beta4, a new disulfide-linked auxiliary subunit with similarity to beta2. J Neurosci. 2003 Aug 20;23(20):7577-85. [PubMed:12930796 ]
  3. Medeiros-Domingo A, Kaku T, Tester DJ, Iturralde-Torres P, Itty A, Ye B, Valdivia C, Ueda K, Canizales-Quinteros S, Tusie-Luna MT, Makielski JC, Ackerman MJ: SCN4B-encoded sodium channel beta4 subunit in congenital long-QT syndrome. Circulation. 2007 Jul 10;116(2):134-42. Epub 2007 Jun 25. [PubMed:17592081 ]