You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09098
Secondary Accession Numbers
  • 14842
Name Y+L amino acid transporter 2
Synonyms
  1. Cationic amino acid transporter, y+ system
  2. Solute carrier family 7 member 6
  3. Y+LAT2
  4. y(+)L-type amino acid transporter 2
  5. y+LAT-2
Gene Name SLC7A6
Protein Type Unknown
Biological Properties
General Function Involved in transport
Specific Function Involved in the sodium-independent uptake of dibasic amino acids and sodium-dependent uptake of some neutral amino acids. Requires co-expression with SLC3A2/4F2hc to mediate the uptake of arginine, leucine and glutamine. Also acts as an arginine/glutamine exchanger, following an antiport mechanism for amino acid transport, influencing arginine release in exchange for extracellular amino acids. Plays a role in nitric oxide synthesis in human umbilical vein endothelial cells (HUVECs) via transport of L-arginine. Involved in the transport of L-arginine in monocytes. Reduces uptake of ornithine in retinal pigment epithelial (RPE) cells
Pathways
  • Amiloride Action Pathway
  • Bendroflumethiazide Action Pathway
  • Blue diaper syndrome
  • Bumetanide Action Pathway
  • Chlorothiazide Action Pathway
  • Chlorthalidone Action Pathway
  • Cyclothiazide Action Pathway
  • Cystinuria
  • Eplerenone Action Pathway
  • Ethacrynic Acid Action Pathway
  • Furosemide Action Pathway
  • Glucose Transporter Defect (SGLT2)
  • Hartnup Disorder
  • Hydrochlorothiazide Action Pathway
  • Hydroflumethiazide Action Pathway
  • Iminoglycinuria
  • Indapamide Action Pathway
  • Kidney Function
  • Lysinuric Protein Intolerance
  • Lysinuric protein intolerance (LPI)
  • Methyclothiazide Action Pathway
  • Metolazone Action Pathway
  • Polythiazide Action Pathway
  • Quinethazone Action Pathway
  • Spironolactone Action Pathway
  • Torsemide Action Pathway
  • Triamterene Action Pathway
  • Trichlormethiazide Action Pathway
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
active transmembrane transporter activity
transmembrane transporter activity
amine transmembrane transporter activity
amino acid transmembrane transporter activity
transporter activity
Process
establishment of localization
transport
amine transport
amino acid transport
transmembrane transport
Cellular Location
  1. Multi-pass membrane protein
  2. Basolateral cell membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 16q22.1
SNPs SLC7A6
Gene Sequence
>1548 bp
ATGGAAGCCAGGGAGCCTGGGAGGCCCACACCCACCTACCATCTTGTCCCTAACACCAGC
CAGTCCCAGGTGGAAGAAGATGTCAGCTCGCCACCTCAAAGGTCCTCCGAAACTATGCAG
CTGAAGAAGGAGATCTCCCTGCTGAATGGGGTCAGCCTGGTGGTGGGCAACATGATCGGC
TCAGGGATCTTTGTCTCACCCAAGGGTGTGCTGGTACACACTGCCTCCTATGGGATGTCA
CTGATTGTGTGGGCCATTGGTGGGCTCTTCTCTGTTGTGGGTGCCCTTTGTTATGCAGAG
CTGGGGACCACCATCACCAAGTCGGGAGCCAGCTACGCTTATATTCTAGAGGCCTTTGGG
GGCTTCATTGCCTTCATCCGCCTGTGGGTCTCACTGCTAGTTGTTGAGCCCACCGGTCAG
GCCATCATCGCCATCACCTTTGCCAACTACATCATCCAGCCGTCCTTCCCCAGCTGTGAT
CCCCCATACCTGGCCTGCCGTCTCCTGGCTGCTGCTTGCATATGTCTGCTGACATTTGTG
AACTGTGCCTATGTCAAGTGGGGCACACGTGTGCAGGACACGTTCACTTACGCCAAGGTC
GTAGCGCTCATTGCCATCATTGTCATGGGCCTTGTTAAACTGTGCCAGGGACACTCTGAG
CACTTTCAGGACGCCTTTGAGGGTTCCTCCTGGGACATGGGAAACCTCTCTCTTGCCCTC
TACTCTGCCCTCTTCTCTTACTCAGGTTGGGACACCCTTAATTTTGTAACAGAAGAAATC
AAAAACCCAGAAAGAAATTTGCCCTTGGCCATTGGGATTTCTATGCCAATTGTGACGCTC
ATCTACATCCTGACCAATGTGGCCTATTACACAGTGCTGAACATTTCAGATGTCCTTAGC
AGTGATGCTGTGGCTGTGACATTTGCTGACCAGACGTTTGGCATGTTCAGCTGGACCATC
CCCATTGCTGTTGCCCTGTCCTGCTTTGGGGGCCTCAATGCATCCATCTTTGCTTCATCA
AGGTTGTTCTTCGTGGGCTCCCGGGAGGGCCACCTACCGGACCTTCTGTCCATGATCCAC
ATTGAGCGTTTTACACCTATCCCTGCTTTACTGTTCAATTGCACCATGGCACTCATCTAC
CTCATCGTGGAGGATGTTTTCCAGCTTATCAACTACTTCAGCTTCAGCTACTGGTTCTTC
GTGGGCCTGTCTGTTGTTGGACAGCTCTACCTCCGCTGGAAGGAGCCCAAGCGGCCCCGG
CCTCTCAAGCTGAGCGTGTTTTTCCCCATCGTGTTCTGCATATGCTCCGTGTTTCTGGTG
ATAGTGCCCCTCTTCACTGACACCATTAATTCCCTCATTGGCATCGGGATTGCCCTTTCT
GGAGTCCCTTTCTACTTCATGGGTGTTTACCTGCCAGAGTCCCGGAGGCCATTGTTTATT
CGGAATGTCCTGGCTGCTATCACCAGAGGCACCCAGCAGCTTTGCTTTTGTGTCCTGACT
GAGCTTGATGTAGCCGAAGAAAAAAAGGATGAGAGGAAAACTGACTAG
Protein Properties
Number of Residues 515
Molecular Weight 56826.9
Theoretical pI 5.69
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 45-65
  • 79-99
  • 115-135
  • 168-188
  • 195-215
  • 236-256
  • 267-287
  • 312-332
  • 364-384
  • 386-406
  • 426-446
  • 452-472
Protein Sequence
>Y+L amino acid transporter 2
MEAREPGRPTPTYHLVPNTSQSQVEEDVSSPPQRSSETMQLKKEISLLNGVSLVVGNMIG
SGIFVSPKGVLVHTASYGMSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFG
GFIAFIRLWVSLLVVEPTGQAIIAITFANYIIQPSFPSCDPPYLACRLLAAACICLLTFV
NCAYVKWGTRVQDTFTYAKVVALIAIIVMGLVKLCQGHSEHFQDAFEGSSWDMGNLSLAL
YSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNISDVLS
SDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPDLLSMIH
IERFTPIPALLFNCTMALIYLIVEDVFQLINYFSFSYWFFVGLSVVGQLYLRWKEPKRPR
PLKLSVFFPIVFCICSVFLVIVPLFTDTINSLIGIGIALSGVPFYFMGVYLPESRRPLFI
RNVLAAITRGTQQLCFCVLTELDVAEEKKDERKTD
GenBank ID Protein 20381372
UniProtKB/Swiss-Prot ID Q92536
UniProtKB/Swiss-Prot Entry Name YLAT2_HUMAN
PDB IDs Not Available
GenBank Gene ID BC028216
GeneCard ID SLC7A6
GenAtlas ID SLC7A6
HGNC ID HGNC:11064
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  3. Nagase T, Seki N, Ishikawa K, Ohira M, Kawarabayasi Y, Ohara O, Tanaka A, Kotani H, Miyajima N, Nomura N: Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain. DNA Res. 1996 Oct 31;3(5):321-9, 341-54. [PubMed:9039502 ]
  4. Broer A, Friedrich B, Wagner CA, Fillon S, Ganapathy V, Lang F, Broer S: Association of 4F2hc with light chains LAT1, LAT2 or y+LAT2 requires different domains. Biochem J. 2001 May 1;355(Pt 3):725-31. [PubMed:11311135 ]
  5. Torrents D, Estevez R, Pineda M, Fernandez E, Lloberas J, Shi YB, Zorzano A, Palacin M: Identification and characterization of a membrane protein (y+L amino acid transporter-1) that associates with 4F2hc to encode the amino acid transport activity y+L. A candidate gene for lysinuric protein intolerance. J Biol Chem. 1998 Dec 4;273(49):32437-45. [PubMed:9829974 ]
  6. Dall'Asta V, Bussolati O, Sala R, Rotoli BM, Sebastio G, Sperandeo MP, Andria G, Gazzola GC: Arginine transport through system y(+)L in cultured human fibroblasts: normal phenotype of cells from LPI subjects. Am J Physiol Cell Physiol. 2000 Dec;279(6):C1829-37. [PubMed:11078698 ]
  7. Sala R, Rotoli BM, Colla E, Visigalli R, Parolari A, Bussolati O, Gazzola GC, Dall'Asta V: Two-way arginine transport in human endothelial cells: TNF-alpha stimulation is restricted to system y(+). Am J Physiol Cell Physiol. 2002 Jan;282(1):C134-43. [PubMed:11742806 ]
  8. Arancibia-Garavilla Y, Toledo F, Casanello P, Sobrevia L: Nitric oxide synthesis requires activity of the cationic and neutral amino acid transport system y+L in human umbilical vein endothelium. Exp Physiol. 2003 Nov;88(6):699-710. [PubMed:14603368 ]
  9. Rotoli BM, Bussolati O, Sala R, Barilli A, Talarico E, Gazzola GC, Dall'Asta V: INFgamma stimulates arginine transport through system y+L in human monocytes. FEBS Lett. 2004 Jul 30;571(1-3):177-81. [PubMed:15280038 ]
  10. Rotmann A, Simon A, Martine U, Habermeier A, Closs EI: Activation of classical protein kinase C decreases transport via systems y+ and y+L. Am J Physiol Cell Physiol. 2007 Jun;292(6):C2259-68. Epub 2007 Feb 28. [PubMed:17329401 ]
  11. Kaneko S, Ando A, Okuda-Ashitaka E, Maeda M, Furuta K, Suzuki M, Matsumura M, Ito S: Ornithine transport via cationic amino acid transporter-1 is involved in ornithine cytotoxicity in retinal pigment epithelial cells. Invest Ophthalmol Vis Sci. 2007 Jan;48(1):464-71. [PubMed:17197568 ]
  12. Sperandeo MP, Paladino S, Maiuri L, Maroupulos GD, Zurzolo C, Taglialatela M, Andria G, Sebastio G: A y(+)LAT-1 mutant protein interferes with y(+)LAT-2 activity: implications for the molecular pathogenesis of lysinuric protein intolerance. Eur J Hum Genet. 2005 May;13(5):628-34. [PubMed:15756301 ]
  13. Broer A, Wagner CA, Lang F, Broer S: The heterodimeric amino acid transporter 4F2hc/y+LAT2 mediates arginine efflux in exchange with glutamine. Biochem J. 2000 Aug 1;349 Pt 3:787-95. [PubMed:10903140 ]
  14. Chubb S, Kingsland AL, Broer A, Broer S: Mutation of the 4F2 heavy-chain carboxy terminus causes y+ LAT2 light-chain dysfunction. Mol Membr Biol. 2006 May-Jun;23(3):255-67. [PubMed:16785209 ]