You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09105
Secondary Accession Numbers
  • 14849
Name Laminin subunit alpha-1
Synonyms
  1. Laminin A chain
  2. Laminin-1 subunit alpha
  3. Laminin-3 subunit alpha
  4. S-LAM alpha
  5. S-laminin subunit alpha
Gene Name LAMA1
Protein Type Unknown
Biological Properties
General Function Involved in cell adhesion
Specific Function Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components
Pathways Not Available
Reactions Not Available
GO Classification
Component
extracellular region part
extracellular matrix
basement membrane
laminin complex
macromolecular complex
protein complex
proteinaceous extracellular matrix
extracellular matrix part
laminin-1 complex
Function
binding
protein binding
receptor binding
Process
cell adhesion
cellular process
regulation of embryonic development
biological regulation
regulation of biological process
regulation of cellular process
regulation of cell adhesion
regulation of locomotion
regulation of cell motility
regulation of cell migration
regulation of developmental process
regulation of multicellular organismal development
Cellular Location
  1. Secreted
  2. extracellular space
  3. extracellular matrix
  4. basement membrane
Gene Properties
Chromosome Location Chromosome:1
Locus 18p11.3
SNPs LAMA1
Gene Sequence
>9228 bp
ATGCGCGGGGGCGTGCTCCTGGTCTTGCTGCTGTGTGTCGCCGCGCAGTGCCGGCAGAGA
GGCCTGTTTCCTGCCATTCTCAATCTTGCCAGCAATGCTCACATCAGCACCAATGCCACC
TGTGGCGAGAAGGGGCCGGAGATGTTCTGCAAACTTGTGGAGCATGTGCCAGGTCGGCCC
GTCCGAAACCCACAGTGCCGGATCTGTGATGGCAACAGCGCAAACCCCAGAGAACGCCAT
CCAATATCACATGCCATAGATGGCACCAATAACTGGTGGCAAAGTCCCAGCATTCAGAAT
GGGAGAGAATATCACTGGGTCACAATCACTCTGGACTTAAGACAGGTCTTTCAAGTTGCA
TATGTCATCATTAAAGCTGCCAATGCCCCTCGACCTGGAAACTGGATTTTGGAGCGTTCT
CTGGATGGCACCACGTTCAGCCCCTGGCAGTATTATGCAGTCAGCGACTCAGAGTGTTTG
TCTCGTTACAATATAACTCCAAGACGAGGGCCACCCACCTACAGGGCTGATGATGAAGTG
ATCTGCACCTCCTATTATTCCAGATTGGTGCCACTTGAGCATGGAGAGATTCATACATCA
CTCATCAATGGCAGACCAAGCGCTGACGATCTTTCACCCAAGTTGTTGGAATTCACTTCT
GCACGATATATTCGCCTTCGCTTGCAACGCATTAGAACGCTCAATGCAGATCTCATGACC
CTTAGCCACCGGGAACCTAAAGAACTGGATCCTATTGTTACCAGACGCTATTATTATTCA
ATAAAGGACATTTCTGTTGGAGGCATGTGTATCTGCTATGGCCATGCTAGTAGCTGCCCA
TGGGATGAAACTACAAAGAAACTGCAGTGTCAATGTGAGCATAATACTTGCGGGGAGAGC
TGTAACAGGTGCTGTCCTGGGTACCATCAGCAGCCCTGGAGGCCGGGAACCGTGTCCTCC
GGCAATACATGTGAAGCATGTAATTGTCACAATAAAGCCAAAGACTGTTACTATGATGAA
AGTGTTGCAAAGCAGAAGAAAAGTTTGAATACTGCTGGACAGTTCAGAGGAGGAGGGGTT
TGCATAAATTGCTTGCAGAACACCATGGGAATCAACTGTGAAACCTGTATTGATGGATAT
TATAGACCACACAAAGTGTCTCCTTATGAGGATGAGCCTTGCCGCCCCTGTAATTGTGAC
CCTGTGGGGTCCCTCAGTTCTGTCTGTATTAAGGATGACCTCCATTCTGACTTACACAAT
GGGAAGCAGCCAGGTCAGTGCCCATGTAAGGAAGGTTATACAGGAGAAAAATGTGATCGC
TGCCAACTTGGCTATAAGGATTACCCGACCTGTGTCTCCTGTGGGTGCAACCCAGTGGGC
AGTGCCAGTGATGAGCCCTGCACAGGGCCCTGTGTTTGTAAGGAAAACGTTGAGGGGAAG
GCCTGTGATCGCTGCAAGCCAGGATTCTATAACTTGAAGGAAAAAAACCCCCGGGGCTGC
TCCGAGTGCTTCTGCTTTGGCGTTTCTGATGTCTGCAGCAGCCTCTCTTGGCCTGTTGGT
CAGGTAAACAGTATGTCCGGGTGGCTGGTCACCGACTTGATCAGTCCCAGGAAGATCCCG
TCTCAGCAAGATGCACTAGGCGGGCGCCATCAGGTCAGCATCAACAACACCGCGGTCATG
CAGAGACTGGCTCCCAAGTACTACTGGGCAGCCCCCGAGGCCTACCTTGGAAATAAGCTG
ACTGCGTTTGGCGGATTCCTGAAATACACGGTGTCCTACGATATTCCGGTAGAGACGGTA
GACAGTAACCTCATGTCGCATGCTGACGTCATCATTAAGGGAAACGGACTCACTTTAAGC
ACACAGGCTGAGGGTCTGTCATTGCAGCCTTATGAAGAGTACCTAAACGTGGTTAGACTT
GTGCCTGAAAACTTCCAAGATTTTCACAGCAAAAGGCAGATTGATCGTGACCAGCTGATG
ACTGTCCTTGCCAATGTGACACATCTTTTGATCAGAGCCAACTACAATTCTGCAAAAATG
GCTCTTTACAGGTTGGAGTCCGTCTCTCTGGACATAGCCAGCTCTAATGCCATCGACCTG
GTGGTGGCCGCTGATGTGGAGCACTGTGAATGTCCGCAAGGCTACACAGGGACCTCCTGT
GAGTCGTGCCTCTCTGGCTATTACCGCGTGGATGGAATACTCTTTGGAGGAATTTGTCAA
CCCTGTGAATGCCACGGCCATGCAGCTGAGTGTAATGTTCACGGCGTTTGCATTGCGTGT
GCGCACAACACCACCGGCGTCCACTGTGAGCAGTGCTTGCCCGGCTTCTACGGGGAGCCT
TCCCGAGGGACACCTGGGGACTGCCAGCCCTGCGCCTGCCCTCTCACCATAGCCTCCAAC
AATTTCAGCCCCACCTGCCACCTCAATGATGGAGATGAAGTGGTCTGTGACTGGTGTGCC
CCGGGCTACTCAGGAGCTTGGTGTGAGAGATGTGCAGATGGTTACTATGGAAACCCAACA
GTGCCTGGCGAATCTTGTGTTCCCTGTGACTGCAGCGGCAACGTGGACCCCTCGGAGGCT
GGTCACTGTGACTCAGTCACCGGGGAGTGCCTGAAGTGCCTGGGGAACACAGATGGCGCC
CACTGTGAAAGGTGTGCTGACGGGTTCTATGGGGACGCTGTGACAGCCAAGAACTGCCGC
GCCTGTGAATGCCATGTGAAAGGCTCCCATTCTGCCGTGTGCCATCTTGAGACCGGGCTC
TGTGACTGCAAACCAAACGTGACTGGACAGCAGTGTGACCAGTGCTTGCATGGCTATTAT
GGGCTGGACTCAGGCCATGGCTGCCGGCCCTGCAACTGCAGCGTGGCAGGCTCCGTGTCA
GATGGCTGCACGGATGAAGGCCAGTGTCACTGTGTCCCAGGTGTGGCAGGGAAAAGGTGT
GACAGGTGTGCCCATGGCTTCTACGCCTACCAGGATGGTAGCTGTACACCCTGTGACTGC
CCACACACTCAGAATACCTGCGACCCAGAAACTGGAGAGTGTGTCTGCCCCCCTCACACA
CAGGGTGTGAAGTGTGAAGAATGTGAGGATGGGCACTGGGGCTACGATGCGGAGGTGGGG
TGCCAGGCCTGCAATTGCAGTCTCGTGGGGTCGACTCATCATCGGTGCGATGTGGTCACC
GGCCATTGCCAGTGCAAGTCAAAATTTGGTGGCCGGGCCTGCGATCAGTGTTCCTTGGGT
TACAGAGACTTTCCCGACTGTGTTCCCTGTGACTGTGACCTGAGGGGGACGTCGGGGGAC
GCCTGCAACCTGGAGCAGGGTCTCTGCGGCTGTGTGGAGGAAACCGGGGCCTGCCCTTGC
AAGGAAAATGTCTTTGGTCCTCAGTGCAACGAATGTCGAGAGGGCACCTTCGCTCTCCGC
GCAGACAACCCCCTGGGCTGCAGCCCGTGCTTCTGCTCCGGGCTGTCCCACCTCTGCTCA
GAGCTGGAGGACTACGTGAGGACCCCAGTAACGCTGGGCTCCGATCAGCCTCTTCTGCGT
GTGGTTTCTCAGAGTAACTTGAGGGGCACGACCGAGGGGGTTTACTACCAGGCCCCCGAC
TTCCTGCTGGATGCCGCCACCGTCCGGCAGCACATCCGTGCAGAGCCGTTTTACTGGCGG
CTGCCGCAGCAGTTCCAAGGAGACCAGCTCATGGCCTATGGTGGCAAACTGAAGTACAGC
GTGGCCTTCTATTCTTTGGATGGCGTCGGCACCTCCAATTTTGAGCCTCAAGTTCTCATC
AAAGGTGGTCGGATCAGAAAGCAAGTCATTTACATGGATGCACCAGCCCCAGAGAATGGA
GTGAGACAGGAACAAGAAGTAGCAATGAGAGAGAATTTTTGGAAATATTTTAACTCTGTT
TCTGAAAAACCTGTCACGCGAGAGGATTTTATGTCTGTCCTCAGCGATATTGAGTACATC
CTCATCAAGGCATCGTATGGTCAAGGATTACAGCAGAGCAGAATCTCAGACATTTCAATG
GAGGTTGGCAGAAAGGCTGAAAAGCTGCACCCAGAAGAAGAGGTTGCATCTCTTTTAGAG
AATTGTGTCTGTCCTCCTGGCACTGTGGGATTCTCATGTCAGGACTGCGCCCCTGGGTAC
CACAGAGGGAAGCTCCCAGCAGGGAGTGACAGGGGACCACGCCCTCTGGTTGCTCCTTGT
GTTCCCTGCAGTTGCAACAACCACAGTGACACCTGTGACCCCAACACCGGGAAGTGTCTG
AACTGTGGCGATAACACAGCAGGTGACCATTGTGATGTGTGTACTTCTGGCTACTACGGG
AAGGTGACTGGCTCAGCAAGTGACTGTGCTCTGTGTGCCTGTCCTCACAGCCCTCCTGCC
AGTTTTAGTCCCACTTGTGTCTTGGAAGGGGACCACGATTTCCGTTGTGACGCCTGTCTC
CTGGGCTATGAAGGAAAACACTGTGAAAGGTGCTCCTCAAGCTATTATGGGAACCCTCAA
ACACCAGGTGGCAGTTGCCAGAAGTGTGACTGCAACCCGCACGGCTCTGTCCACGGTGAC
TGTGACCGCACATCTGGGCAGTGCGTTTGCAGGCTGGGGGCCTCGGGGCTCCGGTGCGAT
GAGTGTGAACCGAGGCACATTCTGATGGAAACAGATTGTGTTTCCTGTGATGATGAGTGT
GTAGGTGTGCTGCTGAATGACTTGGATGAGATTGGTGATGCCGTTCTTTCTCTGAACCTC
ACTGGCATTATCCCTGTCCCATATGGAATTTTGTCAAACCTGGAAAATACAACTAAATAT
CTCCAGGAATCTTTATTAAAAGAAAATATGCAAAAGGACCTGGGAAAAATTAAGCTTGAA
GGTGTTGCAGAAGAAACGGACAACCTGCAAAAGAAGCTCACTAGGATGTTAGCGAGTACC
CAAAAGGTGAATAGGGCAACTGAGAGAATCTTCAAGGAGAGTCAAGACCTGGCCATAGCC
ATTGAGAGGCTGCAGATGAGCATCACAGAAATTATGGAAAAGACAACTTTAAATCAGACT
TTGGATGAAGATTTCCTACTACCCAATTCTACTCTTCAGAACATGCAACAGAATGGTACA
TCTTTGCTAGAAATCATGCAGATAAGAGACTTCACACAGTTGCACCAAAATGCCACCCTT
GAACTCAAGGCTGCTGAAGATTTATTGTCACAAATTCAGGAAAATTACCAGAAGCCGCTG
GAAGAATTGGAGGTATTGAAAGAAGCAGCAAGCCACGTCCTTTCAAAGCACAACAATGAA
CTAAAGGCGGCTGAGGCGCTCGTGAGGGAAGCTGAGGCAAAGATGCAGGAAAGCAACCAC
CTGCTGCTCATGGTCAATGCTAATCTGAGAGAATTCAGTGATAAAAAGCTGCATGTTCAA
GAAGAACAAAATCTGACCTCAGAGCTCATTGTCCAAGGAAGAGGATTGATAGATGCTGCT
GCTGCACAAACAGATGCTGTACAAGATGCTCTAGAGCACTTAGAGGATCACCAGGATAAG
CTACTTTTATGGTCTGCCAAAATCAGGCACCACATAGATGACCTGGTCATGCACATGTCC
CAAAGGAACGCAGTCGACCTGGTCTACAGAGCTGAGGACCATGCCGCTGAGTTCCAGAGA
CTAGCAGATGTTCTGTACAGTGGCCTTGAAAACATCAGAAATGTGTCCCTGAATGCCACC
AGTGCAGCCTATGTCCATTACAACATCCAGAGCCTGATTGAAGAATCGGAGGAACTGGCC
AGAGATGCTCACAGGACTGTGACTGAGACGAGCCTGCTCTCAGAATCCCTTGTTTCTAAC
GGGAAAGCGGCCGTGCAGCGCAGCTCCAGATTTCTAAAAGAAGGCAACAACCTCAGCAGG
AAGCTTCCAGGTATTGCATTGGAACTGAGTGAATTGAGAAATAAGACAAACAGATTTCAA
GAGAATGCTGTTGAAATTACCAGGCAAACCAATGAATCACTCTTGATACTTAGAGCAATT
CCTAAAGGTATAAGAGACAAGGGAGCCAAAACCAAAGAGCTGGCCACGTCTGCAAGCCAG
AGCGCGGTGAGCACGCTGAGGGACGTGGCGGGGCTGAGCCAGGAGCTGCTGAACACATCT
GCCAGCCTGTCCAGGGTCAACACCACATTACGAGAGACACACCAGCTTCTGCAGGACTCC
ACCATGGCCACTCTGTTGGCTGGAAGAAAAGTCAAAGACGTGGAAATTCAAGCCAACCTT
TTGTTTGATCGGTTGAAGCCTTTGAAGATGTTAGAGGAGAATCTGAGCAGAAACCTATCA
GAAATTAAACTGTTGATCAGCCAGGCCCGCAAACAAGCAGCTTCTATTAAAGTCGCCGTG
TCTGCAGACAGAGATTGCATCCGGGCCTACCAGCCTCAGATTTCCTCTACCAACTACAAT
ACCTTAACACTAAATGTTAAGACACAGGAACCCGATAATCTTCTCTTCTACCTCGGTAGC
AGCACCGCTTCTGATTTCCTTGCAGTGGAGATGCGGCGAGGGAGAGTGGCCTTCCTGTGG
GACCTGGGCTCCGGGTCCACACGCTTGGAGTTTCCAGACTTTCCCATTGATGACAACAGA
TGGCACAGTATCCATGTAGCCAGATTTGGAAACATTGGTTCACTGAGTGTAAAGGAAATG
AGCTCAAATCAAAAGTCACCAACAAAAACAAGTAAATCCCCTGGGACAGCTAATGTTCTG
GATGTAAACAATTCAACACTCATGTTTGTTGGAGGTCTTGGAGGACAAATCAAGAAATCT
CCTGCTGTGAAGGTTACTCATTTTAAAGGCTGCTTGGGGGAGGCCTTCCTGAATGGAAAA
TCCATAGGCCTATGGAACTATATTGAAAGGGAAGGCAAGTGCCGTGGGTGCTTCGGAAGC
TCCCAGAATGAAGACCCTTCCTTCCATTTTGACGGGAGTGGGTACTCTGTCGTGGAGAAG
TCACTTCCGGCTACCGTGACCCAGATAATCATGCTTTTTAATACCTTTTCACCTAATGGA
CTTCTTCTCTACCTGGGTTCATACGGCACAAAAGACTTTTTATCCATCGAGCTGTTTCGT
GGCAGAGTGAAGGTTATGACTGACCTGGGTTCAGGACCCATTACCCTTTTGACAGACAGA
CGTTATAACAATGGAACCTGGTACAAAATTGCCTTCCAGCGAAACCGGAAGCAAGGAGTG
CTAGCAGTTATCGATGCCTATAACACCAGTAATAAAGAAACCAAGCAGGGCGAGACTCCG
GGAGCATCTTCTGACCTCAACCGCCTAGACAAGGACCCGATTTATGTGGGTGGATTACCA
AGGTCAAGAGTTGTAAGGAGAGGTGTCACCACCAAAAGCTTTGTGGGCTGCATCAAGAAC
CTGGAAATATCCAGATCAACCTTTGACTTACTCAGAAATTCCTATGGAGTGAGAAAAGGC
TGTTTACTGGAGCCCATCCGGAGTGTTAGCTTCCTGAAAGGCGGCTACATTGAATTGCCA
CCCAAATCTTTGTCACCAGAATCAGAATGGCTGGTAACATTTGCCACCACGAACAGCAGT
GGCATCATCCTGGCTGCCCTCGGCGGGGATGTGGAGAAGCGGGGTGATCGTGAGGAAGCA
CACGTGCCCTTCTTTTCCGTCATGCTGATCGGAGGCAACATTGAGGTACATGTCAATCCT
GGGGATGGGACAGGCCTGAGAAAAGCTCTCCTGCACGCTCCCACGGGTACCTGCAGTGAT
GGACAAGCGCATTCCATCTCCTTGGTCAGGAATCGGAGAATTATCACTGTCCAATTGGAT
GAGAACAATCCTGTGGAAATGAAGTTGGGCACATTAGTAGAAAGCAGGACGATAAATGTG
TCCAATCTGTACGTCGGGGGAATTCCAGAGGGAGAGGGGACGTCACTGCTCACAATGAGA
AGATCGTTCCATGGCTGTATCAAAAACCTGATCTTCAATTTGGAACTTTTGGATTTCAAC
AGTGCAGTTGGCCATGAGCAAGTCGACCTGGACACCTGCTGGCTGTCAGAAAGGCCTAAG
CTGGCTCCCGATGCAGAGGACAGCAAGCTCTTGCCAGAGCCCCGGGCTTTTCCAGAACAG
TGTGTGGTGGATGCAGCTCTGGAGTACGTTCCCGGCGCTCACCAGTTTGGTCTCACACAA
AACAGCCATTTCATCTTGCCTTTTAATCAGTCGGCTGTCAGAAAGAAGCTCTCGGTTGAG
CTAAGCATCCGCACGTTCGCCTCCAGCGGCCTGATTTACTACATGGCTCATCAGAACCAA
GCAGACTACGCTGTGCTCCAGCTGCACGGGGGCCGCCTCCACTTCATGTTTGACCTTGGC
AAAGGCAGAACAAAGGTCTCTCACCCTGCACTGCTCAGTGATGGCAAGTGGCACACGGTC
AAGACAGACTATGTTAAAAGAAAAGGCTTCATAACTGTCGACGGCCGAGAGTCTCCCATG
GTGACTGTGGTGGGAGATGGAACCATGCTGGATGTGGAGGGTTTGTTCTACCTAGGAGGC
CTGCCCTCCCAGTACCAGGCCAGGAAAATTGGAAATATCACCCACAGCATCCCTGCCTGC
ATTGGGGATGTGACGGTTAACAGCAAACAGCTGGACAAGGACAGCCCGGTGTCTGCCTTC
ACGGTGAACAGGTGCTACGCAGTGGCCCAGGAAGGAACATACTTTGACGGAAGCGGATAT
GCAGCTCTTGTCAAAGAGGGCTACAAAGTCCAGTCAGATGTGAACATCACACTGGAGTTT
CGAACCTCCTCGCAGAATGGCGTCCTCCTGGGGATCAGCACTGCCAAAGTGGATGCCATT
GGACTAGAGCTTGTGGACGGCAAGGTCTTGTTCCATGTCAACAATGGTGCTGGCAGGATA
ACAGCTGCATATGAGCCCAAAACCGCCACTGTGCTCTGTGATGGAAAATGGCACACTCTT
CAAGCTAACAAAAGCAAACACCGTATCACTCTGATTGTTGACGGGAACGCAGTTGGCGCT
GAAAGTCCACACACCCAGTCTACCTCAGTGGACACCAACAATCCCATTTATGTTGGTGGC
TATCCTGCTGGTGTGAAGCAAAAATGCCTGCGCAGCCAGACCTCGTTCCGCGGGTGTTTG
AGGAAGCTAGCTCTGATTAAGAGCCCGCAGGTGCAGTCCTTTGACTTCAGCAGAGCGTTC
GAACTGCACGGAGTTTTCCTTCATTCCTGTCCTGGGACCGAGTCCTGA
Protein Properties
Number of Residues 3075
Molecular Weight 337080.9
Theoretical pI 6.31
Pfam Domain Function
Signals
  • 1-17
Transmembrane Regions
  • None
Protein Sequence
>Laminin subunit alpha-1
MRGGVLLVLLLCVAAQCRQRGLFPAILNLASNAHISTNATCGEKGPEMFCKLVEHVPGRP
VRNPQCRICDGNSANPRERHPISHAIDGTNNWWQSPSIQNGREYHWVTITLDLRQVFQVA
YVIIKAANAPRPGNWILERSLDGTTFSPWQYYAVSDSECLSRYNITPRRGPPTYRADDEV
ICTSYYSRLVPLEHGEIHTSLINGRPSADDLSPKLLEFTSARYIRLRLQRIRTLNADLMT
LSHREPKELDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDETTKKLQCQCEHNTCGES
CNRCCPGYHQQPWRPGTVSSGNTCEACNCHNKAKDCYYDESVAKQKKSLNTAGQFRGGGV
CINCLQNTMGINCETCIDGYYRPHKVSPYEDEPCRPCNCDPVGSLSSVCIKDDLHSDLHN
GKQPGQCPCKEGYTGEKCDRCQLGYKDYPTCVSCGCNPVGSASDEPCTGPCVCKENVEGK
ACDRCKPGFYNLKEKNPRGCSECFCFGVSDVCSSLSWPVGQVNSMSGWLVTDLISPRKIP
SQQDALGGRHQVSINNTAVMQRLAPKYYWAAPEAYLGNKLTAFGGFLKYTVSYDIPVETV
DSNLMSHADVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFQDFHSKRQIDRDQLM
TVLANVTHLLIRANYNSAKMALYRLESVSLDIASSNAIDLVVAADVEHCECPQGYTGTSC
ESCLSGYYRVDGILFGGICQPCECHGHAAECNVHGVCIACAHNTTGVHCEQCLPGFYGEP
SRGTPGDCQPCACPLTIASNNFSPTCHLNDGDEVVCDWCAPGYSGAWCERCADGYYGNPT
VPGESCVPCDCSGNVDPSEAGHCDSVTGECLKCLGNTDGAHCERCADGFYGDAVTAKNCR
ACECHVKGSHSAVCHLETGLCDCKPNVTGQQCDQCLHGYYGLDSGHGCRPCNCSVAGSVS
DGCTDEGQCHCVPGVAGKRCDRCAHGFYAYQDGSCTPCDCPHTQNTCDPETGECVCPPHT
QGVKCEECEDGHWGYDAEVGCQACNCSLVGSTHHRCDVVTGHCQCKSKFGGRACDQCSLG
YRDFPDCVPCDCDLRGTSGDACNLEQGLCGCVEETGACPCKENVFGPQCNECREGTFALR
ADNPLGCSPCFCSGLSHLCSELEDYVRTPVTLGSDQPLLRVVSQSNLRGTTEGVYYQAPD
FLLDAATVRQHIRAEPFYWRLPQQFQGDQLMAYGGKLKYSVAFYSLDGVGTSNFEPQVLI
KGGRIRKQVIYMDAPAPENGVRQEQEVAMRENFWKYFNSVSEKPVTREDFMSVLSDIEYI
LIKASYGQGLQQSRISDISMEVGRKAEKLHPEEEVASLLENCVCPPGTVGFSCQDCAPGY
HRGKLPAGSDRGPRPLVAPCVPCSCNNHSDTCDPNTGKCLNCGDNTAGDHCDVCTSGYYG
KVTGSASDCALCACPHSPPASFSPTCVLEGDHDFRCDACLLGYEGKHCERCSSSYYGNPQ
TPGGSCQKCDCNPHGSVHGDCDRTSGQCVCRLGASGLRCDECEPRHILMETDCVSCDDEC
VGVLLNDLDEIGDAVLSLNLTGIIPVPYGILSNLENTTKYLQESLLKENMQKDLGKIKLE
GVAEETDNLQKKLTRMLASTQKVNRATERIFKESQDLAIAIERLQMSITEIMEKTTLNQT
LDEDFLLPNSTLQNMQQNGTSLLEIMQIRDFTQLHQNATLELKAAEDLLSQIQENYQKPL
EELEVLKEAASHVLSKHNNELKAAEALVREAEAKMQESNHLLLMVNANLREFSDKKLHVQ
EEQNLTSELIVQGRGLIDAAAAQTDAVQDALEHLEDHQDKLLLWSAKIRHHIDDLVMHMS
QRNAVDLVYRAEDHAAEFQRLADVLYSGLENIRNVSLNATSAAYVHYNIQSLIEESEELA
RDAHRTVTETSLLSESLVSNGKAAVQRSSRFLKEGNNLSRKLPGIALELSELRNKTNRFQ
ENAVEITRQTNESLLILRAIPKGIRDKGAKTKELATSASQSAVSTLRDVAGLSQELLNTS
ASLSRVNTTLRETHQLLQDSTMATLLAGRKVKDVEIQANLLFDRLKPLKMLEENLSRNLS
EIKLLISQARKQAASIKVAVSADRDCIRAYQPQISSTNYNTLTLNVKTQEPDNLLFYLGS
STASDFLAVEMRRGRVAFLWDLGSGSTRLEFPDFPIDDNRWHSIHVARFGNIGSLSVKEM
SSNQKSPTKTSKSPGTANVLDVNNSTLMFVGGLGGQIKKSPAVKVTHFKGCLGEAFLNGK
SIGLWNYIEREGKCRGCFGSSQNEDPSFHFDGSGYSVVEKSLPATVTQIIMLFNTFSPNG
LLLYLGSYGTKDFLSIELFRGRVKVMTDLGSGPITLLTDRRYNNGTWYKIAFQRNRKQGV
LAVIDAYNTSNKETKQGETPGASSDLNRLDKDPIYVGGLPRSRVVRRGVTTKSFVGCIKN
LEISRSTFDLLRNSYGVRKGCLLEPIRSVSFLKGGYIELPPKSLSPESEWLVTFATTNSS
GIILAALGGDVEKRGDREEAHVPFFSVMLIGGNIEVHVNPGDGTGLRKALLHAPTGTCSD
GQAHSISLVRNRRIITVQLDENNPVEMKLGTLVESRTINVSNLYVGGIPEGEGTSLLTMR
RSFHGCIKNLIFNLELLDFNSAVGHEQVDLDTCWLSERPKLAPDAEDSKLLPEPRAFPEQ
CVVDAALEYVPGAHQFGLTQNSHFILPFNQSAVRKKLSVELSIRTFASSGLIYYMAHQNQ
ADYAVLQLHGGRLHFMFDLGKGRTKVSHPALLSDGKWHTVKTDYVKRKGFITVDGRESPM
VTVVGDGTMLDVEGLFYLGGLPSQYQARKIGNITHSIPACIGDVTVNSKQLDKDSPVSAF
TVNRCYAVAQEGTYFDGSGYAALVKEGYKVQSDVNITLEFRTSSQNGVLLGISTAKVDAI
GLELVDGKVLFHVNNGAGRITAAYEPKTATVLCDGKWHTLQANKSKHRITLIVDGNAVGA
ESPHTQSTSVDTNNPIYVGGYPAGVKQKCLRSQTSFRGCLRKLALIKSPQVQSFDFSRAF
ELHGVFLHSCPGTES
GenBank ID Protein 38788416
UniProtKB/Swiss-Prot ID P25391
UniProtKB/Swiss-Prot Entry Name LAMA1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_005559.2
GeneCard ID LAMA1
GenAtlas ID LAMA1
HGNC ID HGNC:6481
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Nusbaum C, Zody MC, Borowsky ML, Kamal M, Kodira CD, Taylor TD, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Abouelleil A, Allen NR, Anderson S, Bloom T, Bugalter B, Butler J, Cook A, DeCaprio D, Engels R, Garber M, Gnirke A, Hafez N, Hall JL, Norman CH, Itoh T, Jaffe DB, Kuroki Y, Lehoczky J, Lui A, Macdonald P, Mauceli E, Mikkelsen TS, Naylor JW, Nicol R, Nguyen C, Noguchi H, O'Leary SB, O'Neill K, Piqani B, Smith CL, Talamas JA, Topham K, Totoki Y, Toyoda A, Wain HM, Young SK, Zeng Q, Zimmer AR, Fujiyama A, Hattori M, Birren BW, Sakaki Y, Lander ES: DNA sequence and analysis of human chromosome 18. Nature. 2005 Sep 22;437(7058):551-5. [PubMed:16177791 ]
  3. Haaparanta T, Uitto J, Ruoslahti E, Engvall E: Molecular cloning of the cDNA encoding human laminin A chain. Matrix. 1991 Jun;11(3):151-60. [PubMed:1714537 ]
  4. Nissinen M, Vuolteenaho R, Boot-Handford R, Kallunki P, Tryggvason K: Primary structure of the human laminin A chain. Limited expression in human tissues. Biochem J. 1991 Jun 1;276 ( Pt 2):369-79. [PubMed:2049067 ]
  5. Olsen D, Nagayoshi T, Fazio M, Peltonen J, Jaakkola S, Sanborn D, Sasaki T, Kuivaniemi H, Chu ML, Deutzmann R, et al.: Human laminin: cloning and sequence analysis of cDNAs encoding A, B1 and B2 chains, and expression of the corresponding genes in human skin and cultured cells. Lab Invest. 1989 Jun;60(6):772-82. [PubMed:2733383 ]