You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09110
Secondary Accession Numbers
  • 14854
Name Solute carrier family 23 member 3
Synonyms
  1. HPC E2-binding protein 3
  2. Na(+)/L-ascorbic acid transporter 3
  3. Sodium-dependent vitamin C transporter 3
Gene Name SLC23A3
Protein Type Unknown
Biological Properties
General Function Involved in transporter activity
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Component
membrane
cell part
Function
transporter activity
Process
establishment of localization
transport
transmembrane transport
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location Chromosome:2
Locus 2q35
SNPs SLC23A3
Gene Sequence
>1833 bp
ATGAGCCGATCACCCCTCAATCCCAGCCAACTCCGATCAGTGGGCTCCCAGGATGCCCTG
GCCCCCTTGCCTCCACCTGCTCCCCAGAATCCCTCCACCCACTCTTGGGACCCTTTGTGT
GGATCTCTGCCTTGGGGCCTCAGCTGTCTTCTGGCTCTGCAGCATGTCTTGGTCATGGCT
TCTCTGCTCTGTGTCTCCCACCTGCTCCTGCTTTGCAGTCTCTCCCCAGGAGGACTCTCT
TACTCCCCTTCTCAGCTCCTGGCCTCCAGCTTCTTTTCATGTGGTATGTCTACCATCCTG
CAAACTTGGATGGGCAGCAGGCTGCCTCTTGTCCAGGCTCCATCCTTAGAGTTCCTTATC
CCTGCTCTGGTGCTGACCAGCCAGAAGCTACCCCGGGCCATCCAGACACCTGGAAACTCC
TCCCTCATGCTGCACCTTTGTAGGGGACCTAGCTGCCATGGCCTGGGGCACTGGAACACT
TCTCTCCAGGAGGTGTCCGGGGCAGTGGTAGTATCTGGGCTGCTGCAGGGCATGATGGGG
CTGCTGGGGAGTCCCGGCCACGTGTTCCCCCACTGTGGGCCCCTGGTGCTGGCTCCCAGC
CTGGTTGTGGCAGGGCTCTCTGCCCACAGGGAGGTAGCCCAGTTCTGCTTCACACACTGG
GGGTTGGCCTTGCTGGTTATCCTGCTCATGGTGGTCTGTTCTCAGCACCTGGGCTCCTGC
CAGTTTCATGTGTGCCCCTGGAGGCGAGCTTCAACGTCATCAACTCACACTCCTCTCCCT
GTCTTCCGGCTCCTTTCGGTGCTGATCCCAGTGGCCTGTGTGTGGATTGTTTCTGCCTTT
GTGGGATTCAGTGTTATCCCCCAGGAACTGTCTGCCCCCACCAAGGCACCATGGATTTGG
CTGCCTCACCCAGGTGAGTGGAATTGGCCTTTGCTGACGCCCAGAGCTCTGGCTGCAGGC
ATCTCCATGGCCTTGGCAGCCTCCACCAGTTCCCTGGGCTGCTATGCCCTGTGTGGCCGG
CTGCTGCATTTGCCTCCCCCACCTCCACATGCCTGCAGTCGAGGGCTGAGCCTGGAGGGG
CTGGGCAGTGTGCTGGCCGGGCTGCTGGGAAGCCCCATGGGCACTGCATCCAGCTTCCCC
AACGTGGGCAAAGTGGGTCTTATCCAGGCTGGATCTCAGCAAGTGGCTCACTTAGTGGGG
CTACTCTGCGTGGGGCTTGGACTCTCCCCCAGGTTGGCTCAGCTCCTCACCACCATCCCA
CTGCCTGTTGTTGGTGGGGTGCTGGGGGTGACCCAGGCTGTGGTTTTGTCTGCTGGATTC
TCCAGCTTCTACCTGGCTGACATAGACTCTGGGCGAAATATCTTCATTGTGGGCTTCTCC
ATCTTCATGGCCTTGCTGCTGCCAAGATGGTTTCGGGAAGCCCCAGTCCTGTTCAGCACA
GGCTGGAGCCCCTTGGATGTATTACTGCACTCACTGCTGACACAGCCCATCTTCCTGGCT
GGACTCTCAGGCTTCCTACTAGAGAACACGATTCCTGGCACACAGCTTGAGCGAGGCCTA
GGTCAAGGGCTACCATCTCCTTTCACTGCCCAAGAGGCTCGAATGCCTCAGAAGCCCAGG
GAGAAGGCTGCTCAAGTGTACAGACTTCCTTTCCCCATCCAAAACCTCTGTCCCTGCATC
CCCCAGCCTCTCCACTGCCTCTGCCCACTGCCTGAAGACCCTGGGGATGAGGAAGGAGGC
TCCTCTGAGCCAGAAGAGATGGCAGACTTGCTGCCTGGCTCAGGGGAGCCATGCCCTGAA
TCTAGCAGAGAAGGGTTTAGGTCCCAGAAATGA
Protein Properties
Number of Residues 610
Molecular Weight 64529.9
Theoretical pI 7.46
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 50-70
  • 86-106
  • 165-185
  • 188-208
  • 212-232
  • 267-287
  • 317-337
  • 356-376
  • 395-414
  • 424-446
  • 453-472
  • 487-507
Protein Sequence
>Solute carrier family 23 member 3
MSRSPLNPSQLRSVGSQDALAPLPPPAPQNPSTHSWDPLCGSLPWGLSCLLALQHVLVMA
SLLCVSHLLLLCSLSPGGLSYSPSQLLASSFFSCGMSTILQTWMGSRLPLVQAPSLEFLI
PALVLTSQKLPRAIQTPGNSSLMLHLCRGPSCHGLGHWNTSLQEVSGAVVVSGLLQGMMG
LLGSPGHVFPHCGPLVLAPSLVVAGLSAHREVAQFCFTHWGLALLVILLMVVCSQHLGSC
QFHVCPWRRASTSSTHTPLPVFRLLSVLIPVACVWIVSAFVGFSVIPQELSAPTKAPWIW
LPHPGEWNWPLLTPRALAAGISMALAASTSSLGCYALCGRLLHLPPPPPHACSRGLSLEG
LGSVLAGLLGSPMGTASSFPNVGKVGLIQAGSQQVAHLVGLLCVGLGLSPRLAQLLTTIP
LPVVGGVLGVTQAVVLSAGFSSFYLADIDSGRNIFIVGFSIFMALLLPRWFREAPVLFST
GWSPLDVLLHSLLTQPIFLAGLSGFLLENTIPGTQLERGLGQGLPSPFTAQEARMPQKPR
EKAAQVYRLPFPIQNLCPCIPQPLHCLCPLPEDPGDEEGGSSEPEEMADLLPGSGEPCPE
SSREGFRSQK
GenBank ID Protein 222080105
UniProtKB/Swiss-Prot ID Q6PIS1
UniProtKB/Swiss-Prot Entry Name S23A3_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001144889.1
GeneCard ID SLC23A3
GenAtlas ID SLC23A3
HGNC ID HGNC:20601
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]