Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09165
Secondary Accession Numbers
  • 14921
Name Neutral ceramidase
Synonyms
  1. Acylsphingosine deacylase 2
  2. BCDase
  3. LCDase
  4. N-CDase
  5. N-acylsphingosine amidohydrolase 2
  6. NCDase
  7. Neutral ceramidase soluble form
  8. Non-lysosomal ceramidase
  9. hCD
Gene Name ASAH2
Protein Type Enzyme
Biological Properties
General Function Involved in ceramidase activity
Specific Function Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid at an optimal pH of 6.5-8.5. Acts as a key regulator of sphingolipid signaling metabolites by generating sphingosine at the cell surface. Acts as a repressor of apoptosis both by reducing C16-ceramide, thereby preventing ceramide-induced apoptosis, and generating sphingosine, a precursor of the antiapoptotic factor sphingosine 1-phosphate. Probably involved in the digestion of dietary sphingolipids in intestine by acting as a key enzyme for the catabolism of dietary sphingolipids and regulating the levels of bioactive sphingolipid metabolites in the intestinal tract.
Pathways Not Available
Reactions
N-acylsphingosine + Water → a carboxylate + Sphingosine details
GO Classification
Biological Process
small molecule metabolic process
signal transduction
phospholipid metabolic process
ceramide metabolic process
apoptotic process
glycosphingolipid metabolic process
Cellular Component
mitochondrion
plasma membrane
integral to membrane
Molecular Function
ceramidase activity
Cellular Location
  1. Cell membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location 10
Locus 10q11.23
SNPs ASAH2
Gene Sequence
>2343 bp
ATGGCCAAACGCACCTTCTCTAACTTGGAGACATTCCTGATTTTCCTCCTTGTAATGATG
AGTGCCATCACAGTGGCCCTTCTCAGCCTCTTGTTTATCACCAGTGGGACCATTGAAAAC
CACAAAGATTTAGGAGGCCATTTTTTTTCAACCACCCAAAGCCCTCCAGCCACCCAGGGC
TCCACAGCTGCCCAACGCTCCACAGCCACCCAGCATTCCACAGCCACCCAGAGCTCCACA
GCCACTCAAACTTCTCCAGTGCCTTTAACCCCAGAGTCTCCTCTATTTCAGAACTTCAGT
GGCTACCATATTGGTGTTGGACGAGCTGACTGCACAGGACAAGTAGCAGATATCAATTTG
ATGGGCTATGGCAAATCCGGCCAGAATGCACAGGGCATCCTCACCAGGCTATACAGTCGT
GCCTTCATCATGGCAGAACCTGATGGGTCCAATCGAACAGTGTTTGTCAGCATCGACATA
GGCATGGTATCACAAAGGCTCAGGCTGGAGGTCCTGAACAGACTGCAGAGTAAATATGGC
TCCCTGTACAGAAGAGATAATGTCATCCTGAGTGGCACTCACACTCATTCAGGTCCTGCA
GGATATTTCCAGTATACCGTGTTTGTAATTGCCAGTGAAGGATTTAGCAATCAAACTTTT
CAGCACATGGTCACTGGTATCTTGAAGAGCATTGACATAGCACACACAAATATGAAACCA
GGCAAAATCTTCATCAATAAAGGAAATGTGGATGGTGTGCAGATCAACAGAAGTCCGTAT
TCTTACCTTCAAAATCCGCAGTCAGAGAGAGCAAGGTATTCTTCAAATACAGACAAGGAA
ATGATAGTTTTGAAAATGGTAGATTTGAATGGAGATGACTTGGGCCTTATCAGCTGGTTT
GCCATCCACCCGGTCAGCATGAACAACAGTAACCATCTTGTAAACAGTGACAATGTGGGC
TATGCATCTTACCTGCTTGAGCAAGAGAAGAACAAAGGATATCTACCTGGACAGGGGCCA
TTTGTAGCAGCCTTTGCTTCATCAAACCTAGGAGATGTGTCCCCCAACATTCTTGGACCA
CGTTGCATCAACACAGGAGAGTCCTGTGATAACGCCAATAGCACTTGTCCCATTGGTGGG
CCTAGCATGTGCATTGCTAAGGGACCTGGACAGGATATGTTTGACAGCACACAAATTATA
GGACGGGCCATGTATCAGAGAGCAAAGGAACTCTATGCCTCTGCCTCCCAGGAGGTAACA
GGACCACTGGCTTCAGCACACCAGTGGGTGGATATGACAGATGTGACTGTCTGGCTCAAT
TCCACACATGCATCAAAAACATGTAAACCAGCATTGGGCTACAGTTTTGCGGCTGGCACT
ATTGATGGAGTTGGAGGCCTCAATTTTACACAGGGGAAAACAGAAGGGGATCCATTTTGG
GACACCATTCGGGACCAGATCCTGGGAAAGCCATCTGAAGAAATTAAAGAATGTCATAAA
CCAAAGCCCATCCTTCTTCACACCGGAGAACTATCAAAACCTCACCCCTGGCATCCAGAC
ATTGTTGATGTTCAGATTATTACCCTTGGGTCCTTGGCCATAACTGCCATCCCCGGGGAG
TTTACGACCATGTCTGGACGAAGACTTCGAGAGGCAGTTCAAGCAGAATTTGCATCTCAT
GGGATGCAGAACATGACTGTTGTTATTTCAGGTCTATGCAACGTCTATACACATTACATT
ACCACTTATGAAGAATACCAGGCTCAGCGATATGAGGCAGCATCGACAATTTATGGACCG
CACACATTATCTGCTTACATTCAGCTCTTCAGAAACCTTGCTAAGGCTATTGCTACGGAC
ACGGTAGCCAACCTGAGCAGAGGTCCAGAACCTCCCTTTTTCAAACAATTAATAGTTCCA
TTAATTCCTAGTATTGTGGATAGAGCACCAAAAGGCAGAACTTTCGGGGATGTCCTGCAG
CCAGCAAAACCTGAATACAGAGTGGGGGAAGTTGCTGAAGTTATATTTGTAGGTGCTAAC
CCGAAGAATTCAGTACAAAACCAGACCCATCAGACCTTCCTCACTGTGGAGAAATATGAG
GCTACTTCAACATCGTGGCAGATAGTGTGTAATGATGCCTCCTGGGAGACTCGTTTTTAT
TGGCACAAGGGACTCCTGGGTCTGAGTAATGCAACAGTGGAATGGCATATTCCAGACACT
GCCCAGCCTGGAATCTACAGAATAAGATATTTTGGACACAATCGGAAGCAGGACATTCTG
AAGCCTGCTGTCATACTTTCATTTGAAGGCACTTCCCCGGCTTTTGAAGTTGTAACTATT
TAG
Protein Properties
Number of Residues 780
Molecular Weight 19024.55
Theoretical pI 9.048
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Neutral ceramidase
MAKRTFSNLETFLIFLLVMMSAITVALLSLLFITSGTIENHKDLGGHFFSTTQSPPATQG
STAAQRSTATQHSTATQSSTATQTSPVPLTPESPLFQNFSGYHIGVGRADCTGQVADINL
MGYGKSGQNAQGILTRLYSRAFIMAEPDGSNRTVFVSIDIGMVSQRLRLEVLNRLQSKYG
SLYRRDNVILSGTHTHSGPAGYFQYTVFVIASEGFSNQTFQHMVTGILKSIDIAHTNMKP
GKIFINKGNVDGVQINRSPYSYLQNPQSERARYSSNTDKEMIVLKMVDLNGDDLGLISWF
AIHPVSMNNSNHLVNSDNVGYASYLLEQEKNKGYLPGQGPFVAAFASSNLGDVSPNILGP
RCINTGESCDNANSTCPIGGPSMCIAKGPGQDMFDSTQIIGRAMYQRAKELYASASQEVT
GPLASAHQWVDMTDVTVWLNSTHASKTCKPALGYSFAAGTIDGVGGLNFTQGKTEGDPFW
DTIRDQILGKPSEEIKECHKPKPILLHTGELSKPHPWHPDIVDVQIITLGSLAITAIPGE
FTTMSGRRLREAVQAEFASHGMQNMTVVISGLCNVYTHYITTYEEYQAQRYEAASTIYGP
HTLSAYIQLFRNLAKAIATDTVANLSRGPEPPFFKQLIVPLIPSIVDRAPKGRTFGDVLQ
PAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASWETRFY
WHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI
GenBank ID Protein 77862360
UniProtKB/Swiss-Prot ID Q9NR71
UniProtKB/Swiss-Prot Entry Name ASAH2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF449759
GeneCard ID ASAH2
GenAtlas ID ASAH2
HGNC ID HGNC:18860
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [PubMed:15164054 ]
  3. Choi MS, Anderson MA, Zhang Z, Zimonjic DB, Popescu N, Mukherjee AB: Neutral ceramidase gene: role in regulating ceramide-induced apoptosis. Gene. 2003 Oct 2;315:113-22. [PubMed:14557071 ]
  4. Osawa Y, Uchinami H, Bielawski J, Schwabe RF, Hannun YA, Brenner DA: Roles for C16-ceramide and sphingosine 1-phosphate in regulating hepatocyte apoptosis in response to tumor necrosis factor-alpha. J Biol Chem. 2005 Jul 29;280(30):27879-87. Epub 2005 Jun 9. [PubMed:15946935 ]
  5. El Bawab S, Roddy P, Qian T, Bielawska A, Lemasters JJ, Hannun YA: Molecular cloning and characterization of a human mitochondrial ceramidase. J Biol Chem. 2000 Jul 14;275(28):21508-13. [PubMed:10781606 ]
  6. Hwang YH, Tani M, Nakagawa T, Okino N, Ito M: Subcellular localization of human neutral ceramidase expressed in HEK293 cells. Biochem Biophys Res Commun. 2005 May 27;331(1):37-42. [PubMed:15845354 ]
  7. Tani M, Sano T, Ito M, Igarashi Y: Mechanisms of sphingosine and sphingosine 1-phosphate generation in human platelets. J Lipid Res. 2005 Nov;46(11):2458-67. Epub 2005 Aug 1. [PubMed:16061940 ]
  8. Galadari S, Wu BX, Mao C, Roddy P, El Bawab S, Hannun YA: Identification of a novel amidase motif in neutral ceramidase. Biochem J. 2006 Feb 1;393(Pt 3):687-95. [PubMed:16229686 ]
  9. Avramopoulos D, Wang R, Valle D, Fallin MD, Bassett SS: A novel gene derived from a segmental duplication shows perturbed expression in Alzheimer's disease. Neurogenetics. 2007 Apr;8(2):111-20. Epub 2007 Feb 16. [PubMed:17334805 ]