You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09166
Secondary Accession Numbers
  • 14922
Name Dermatan-sulfate epimerase
Synonyms
  1. Chondroitin-glucuronate 5-epimerase
  2. DS epimerase
  3. SART-2
  4. Squamous cell carcinoma antigen recognized by T-cells 2
Gene Name DSE
Protein Type Enzyme
Biological Properties
General Function Involved in chondroitin-glucuronate 5-epimerase activity
Specific Function Converts D-glucuronic acid to L-iduronic acid (IdoUA) residues.
Pathways
  • chondroitin sulfate biosynthesis
  • Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
  • heparan sulfate biosynthesis
Reactions
Chondroitin D-glucuronate → dermatan L-iduronate details
Chondroitin → Dermatan details
GO Classification
Biological Process
heparan sulfate proteoglycan biosynthetic process
chondroitin sulfate biosynthetic process
dermatan sulfate biosynthetic process
carbohydrate metabolic process
chondroitin sulfate metabolic process
Cellular Component
endoplasmic reticulum
integral to membrane
Golgi membrane
Molecular Function
chondroitin-glucuronate 5-epimerase activity
Cellular Location
  1. Membrane
  2. Multi-pass membrane protein (Potential)
Gene Properties
Chromosome Location 6
Locus 6q22
SNPs DSE
Gene Sequence
>2877 bp
ATGAGGACTCACACACGGGGGGCTCCCAGTGTGTTTTTCATATATTTGCTTTGCTTTGTG
TCAGCCTACATCACCGACGAGAACCCAGAAGTTATGATTCCCTTCACCAATGCCAACTAC
GACAGCCATCCCATGCTGTACTTCTCCAGGGCAGAAGTGGCGGAGCTGCAGCTCAGGGCT
GCCAGCTCGCACGAGCACATTGCAGCCCGCCTCACGGAGGCTGTGCACACGATGCTGTCC
AGCCCCTTGGAATACCTCCCTCCCTGGGATCCCAAGGACTACAGTGCCCGCTGGAATGAA
ATTTTTGGAAACAACTTGGGTGCCTTGGCAATGTTCTGTGTGCTGTATCCTGAGAACATT
GAAGCCCGAGACATGGCCAAAGACTACATGGAGAGGATGGCAGCGCAGCCTAGTTGGTTG
GTGAAAGATGCTCCTTGGGATGAGGTCCCGCTTGCTCACTCCCTGGTTGGTTTTGCCACT
GCTTATGACTTCTTGTACAACTACCTGAGCAAGACACAACAGGAGAAGTTTCTTGAAGTG
ATTGCCAATGCCTCAGGGTATATGTATGAAACTTCATACAGGAGAGGATGGGGATTTCAA
TACCTGCACAATCATCAGCCCACCAACTGTATGGCTTTGCTCACGGGAAGCCTAGTCCTG
ATGAATCAAGGATATCTTCAAGAAGCCTACTTATGGACCAAACAAGTTCTGACCATCATG
GAGAAATCTCTGGTCTTGCTCAGGGAGGTGACGGATGGCTCCCTCTATGAAGGAGTTGCG
TATGGCAGCTACACCACTAGATCACTCTTCCAATACATGTTTCTCGTCCAGAGGCACTTC
AACATCAACCACTTTGGCCATCCGTGGCTTAAACAACACTTTGCATTTATGTATAGAACC
ATCCTGCCAGGGTTTCAAAGGACTGTGGCTATTGCGGACTCAAATTACAACTGGTTTTAT
GGTCCAGAAAGCCAATTAGTGTTCCTTGATAAATTTGTCATGCGTAATGGCAGTGGTAAC
TGGCTAGCTGACCAAATCAGAAGGAACCGTGTGGTGGAAGGTCCAGGAACACCATCCAAA
GGGCAGCGCTGGTGCACTCTGCACACAGAATTTCTCTGGTATGATGGCAGCTTGAAATCG
GTTCCTCCTCCAGACTTTGGCACCCCTACACTGCATTATTTTGAAGACTGGGGTGTCGTG
ACTTATGGAAGTGCACTACCTGCAGAAATCAATAGATCTTTCCTTTCCTTCAAGTCTGGA
AAACTGGGGGGACGTGCAATATATGACATTGTCCACAGAAACAAATACAAAGATTGGATC
AAAGGATGGAGAAATTTTAATGCAGGGCATGAACATCCTGATCAAAACTCATTTACTTTT
GCTCCCAATGGTGTGCCTTTCATTACTGAGGCTCTGTACGGGCCAAAGTACACCTTCTTC
AACAATGTTTTGATGTTTTCCCCAGCTGTGTCAAAGAGCTGCTTTTCTCCCTGGGTGGGT
CAGGTCACAGAAGACTGCTCATCAAAATGGTCTAAATACAAGCATGACCTGGCAGCTAGT
TGTCAGGGGAGGGTGGTTGCAGCAGAGGAGAAAAATGGGGTGGTTTTCATCCGAGGAGAA
GGTGTGGGAGCTTATAACCCCCAGCTCAACCTGAAGAATGTTCAGAGGAATCTCATCCTC
CTACATCCACAGCTGCTTCTCCTTGTAGACCAAATACACCTGGGAGAGGAGAGTCCCTTG
GAGACAGCAGCGAGCTTCTTCCATAATGTGGATGTTCCTTTTGAGGAGACTGTGGTAGAT
GGTGTCCATGGGGCTTTCATCAGGCAGAGAGATGGTCTCTATAAAATGTACTGGATGGAC
GATACTGGCTACAGCGAGAAAGCAACCTTTGCCTCAGTGACATATCCTCGGGGCTATCCC
TACAACGGGACAAACTATGTGAATGTCACCATGCACCTCCGAAGTCCCATCACCAGGGCA
GCTTACCTCTTCATAGGGCCATCTATAGATGTTCAGAGCTTCACTGTCCACGGAGACTCT
CAGCAACTGGATGTGTTCATAGCCACCAGCAAACATGCCTACGCCACATACCTGTGGACA
GGTGAGGCCACAGGACAGTCTGCCTTTGCACAGGTCATTGCTGATCGTCACAAAATTCTG
TTTGACCGGAATTCAGCCATCAAGAGCAGCATTGTCCCTGAGGTGAAGGACTATGCTGCT
ATTGTGGAACAGAACTTGCAGCATTTTAAACCAGTGTTTCAGCTGCTGGAGAAGCAGATA
CTGTCCCGAGTCCGGAACACAGCTAGCTTTAGGAAGACTGCTGAACGCCTGCTGAGATTT
TCAGATAAGAGACAGACTGAGGAGGCCATTGACAGGATTTTTGCCATATCACAGCAACAG
CAGCAGCAAAGCAAGTCAAAGAAAAACCGAAGGGCAGGCAAACGCTATAAATTTGTGGAT
GCTGTCCCTGATATTTTTGCACAGATTGAAGTCAATGAGAAAAAGATTAGACAGAAAGCT
CAGATTTTGGCACAGAAAGAACTACCCATAGATGAAGATGAAGAAATGAAAGACCTTTTA
GATTTTGCAGATGTAACATACGAGAAACATAAAAATGGGGGCTTGATTAAAGGCCGGTTT
GGACAGGCACGGATGGTGACAACTACACACAGCAGGGCCCCATCACTGTCTGCTTCCTAT
ACCAGGTTGTTCCTGATTCTGAACATTGCTATTTTCTTTGTCATGTTGGCAATGCAACTG
ACTTATTTCCAGAGGGCCCAGAGCCTACATGGCCAAAGATGTCTTTATGCAGTTCTTCTC
ATAGATAGCTGTATTTTATTATGGTTGTACTCTTCTTGTTCCCAATCACAGTGTTAG
Protein Properties
Number of Residues 958
Molecular Weight 109772.235
Theoretical pI 8.087
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Dermatan-sulfate epimerase
MRTHTRGAPSVFFIYLLCFVSAYITDENPEVMIPFTNANYDSHPMLYFSRAEVAELQLRA
ASSHEHIAARLTEAVHTMLSSPLEYLPPWDPKDYSARWNEIFGNNLGALAMFCVLYPENI
EARDMAKDYMERMAAQPSWLVKDAPWDEVPLAHSLVGFATAYDFLYNYLSKTQQEKFLEV
IANASGYMYETSYRRGWGFQYLHNHQPTNCMALLTGSLVLMNQGYLQEAYLWTKQVLTIM
EKSLVLLREVTDGSLYEGVAYGSYTTRSLFQYMFLVQRHFNINHFGHPWLKQHFAFMYRT
ILPGFQRTVAIADSNYNWFYGPESQLVFLDKFVMRNGSGNWLADQIRRNRVVEGPGTPSK
GQRWCTLHTEFLWYDGSLKSVPPPDFGTPTLHYFEDWGVVTYGSALPAEINRSFLSFKSG
KLGGRAIYDIVHRNKYKDWIKGWRNFNAGHEHPDQNSFTFAPNGVPFITEALYGPKYTFF
NNVLMFSPAVSKSCFSPWVGQVTEDCSSKWSKYKHDLAASCQGRVVAAEEKNGVVFIRGE
GVGAYNPQLNLKNVQRNLILLHPQLLLLVDQIHLGEESPLETAASFFHNVDVPFEETVVD
GVHGAFIRQRDGLYKMYWMDDTGYSEKATFASVTYPRGYPYNGTNYVNVTMHLRSPITRA
AYLFIGPSIDVQSFTVHGDSQQLDVFIATSKHAYATYLWTGEATGQSAFAQVIADRHKIL
FDRNSAIKSSIVPEVKDYAAIVEQNLQHFKPVFQLLEKQILSRVRNTASFRKTAERLLRF
SDKRQTEEAIDRIFAISQQQQQQSKSKKNRRAGKRYKFVDAVPDIFAQIEVNEKKIRQKA
QILAQKELPIDEDEEMKDLLDFADVTYEKHKNGGLIKGRFGQARMVTTTHSRAPSLSASY
TRLFLILNIAIFFVMLAMQLTYFQRAQSLHGQRCLYAVLLIDSCILLWLYSSCSQSQC
GenBank ID Protein 6002669
UniProtKB/Swiss-Prot ID Q9UL01
UniProtKB/Swiss-Prot Entry Name DSE_HUMAN
PDB IDs Not Available
GenBank Gene ID AF098066
GeneCard ID DSE
GenAtlas ID DSE
HGNC ID HGNC:21144
References
General References
  1. Mungall AJ, Palmer SA, Sims SK, Edwards CA, Ashurst JL, Wilming L, Jones MC, Horton R, Hunt SE, Scott CE, Gilbert JG, Clamp ME, Bethel G, Milne S, Ainscough R, Almeida JP, Ambrose KD, Andrews TD, Ashwell RI, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beare DM, Beasley H, Beasley O, Bird CP, Blakey S, Bray-Allen S, Brook J, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Clark SY, Clark G, Clee CM, Clegg S, Cobley V, Collier RE, Collins JE, Colman LK, Corby NR, Coville GJ, Culley KM, Dhami P, Davies J, Dunn M, Earthrowl ME, Ellington AE, Evans KA, Faulkner L, Francis MD, Frankish A, Frankland J, French L, Garner P, Garnett J, Ghori MJ, Gilby LM, Gillson CJ, Glithero RJ, Grafham DV, Grant M, Gribble S, Griffiths C, Griffiths M, Hall R, Halls KS, Hammond S, Harley JL, Hart EA, Heath PD, Heathcott R, Holmes SJ, Howden PJ, Howe KL, Howell GR, Huckle E, Humphray SJ, Humphries MD, Hunt AR, Johnson CM, Joy AA, Kay M, Keenan SJ, Kimberley AM, King A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd CR, Lloyd DM, Loveland JE, Lovell J, Martin S, Mashreghi-Mohammadi M, Maslen GL, Matthews L, McCann OT, McLaren SJ, McLay K, McMurray A, Moore MJ, Mullikin JC, Niblett D, Nickerson T, Novik KL, Oliver K, Overton-Larty EK, Parker A, Patel R, Pearce AV, Peck AI, Phillimore B, Phillips S, Plumb RW, Porter KM, Ramsey Y, Ranby SA, Rice CM, Ross MT, Searle SM, Sehra HK, Sheridan E, Skuce CD, Smith S, Smith M, Spraggon L, Squares SL, Steward CA, Sycamore N, Tamlyn-Hall G, Tester J, Theaker AJ, Thomas DW, Thorpe A, Tracey A, Tromans A, Tubby B, Wall M, Wallis JM, West AP, White SS, Whitehead SL, Whittaker H, Wild A, Willey DJ, Wilmer TE, Wood JM, Wray PW, Wyatt JC, Young L, Younger RM, Bentley DR, Coulson A, Durbin R, Hubbard T, Sulston JE, Dunham I, Rogers J, Beck S: The DNA sequence and analysis of human chromosome 6. Nature. 2003 Oct 23;425(6960):805-11. [PubMed:14574404 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Nakao M, Shichijo S, Imaizumi T, Inoue Y, Matsunaga K, Yamada A, Kikuchi M, Tsuda N, Ohta K, Takamori S, Yamana H, Fujita H, Itoh K: Identification of a gene coding for a new squamous cell carcinoma antigen recognized by the CTL. J Immunol. 2000 Mar 1;164(5):2565-74. [PubMed:10679095 ]
  4. Maccarana M, Olander B, Malmstrom J, Tiedemann K, Aebersold R, Lindahl U, Li JP, Malmstrom A: Biosynthesis of dermatan sulfate: chondroitin-glucuronate C5-epimerase is identical to SART2. J Biol Chem. 2006 Apr 28;281(17):11560-8. Epub 2006 Feb 27. [PubMed:16505484 ]