You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09167
Secondary Accession Numbers
  • 14923
Name D-glucuronyl C5-epimerase
Synonyms
  1. Heparin/heparan sulfate:glucuronic acid C5-epimerase
Gene Name GLCE
Protein Type Enzyme
Biological Properties
General Function Involved in racemase and epimerase activity, acting on carbohydrates and derivatives
Specific Function Converts D-glucuronic acid residues adjacent to N- sulfate sugar residues to L-iduronic acids
Pathways Not Available
Reactions Not Available
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
catalytic activity
racemase and epimerase activity
racemase and epimerase activity, acting on carbohydrates and derivatives
isomerase activity
Process
polysaccharide metabolic process
metabolic process
primary metabolic process
carbohydrate metabolic process
polysaccharide biosynthetic process
aminoglycan biosynthetic process
glycosaminoglycan biosynthetic process
Cellular Location
  1. Golgi apparatus membrane
  2. Single-pass type II membrane protein
Gene Properties
Chromosome Location Chromosome:1
Locus 15q23
SNPs GLCE
Gene Sequence
>1854 bp
ATGCGTTGCTTGGCAGCTCGGGTCAACTATAAGACTTTGATTATTATCTGCGCACTCTTC
ACTTTGGTCACAGTACTTTTGTGGAATAAGTGTTCCAGTGACAAAGCAATCCAGTTTCCA
CGGCGTTCGAGTAGTGGCTTCAGAGTGGATGGGTTTGAAAAAAGAGCAGCAGCATCTGAG
AGTAACAACTATATGAACCACGTGGCCAAACAACAGTCTGAGGAAGCATTCCCTCAGGAA
CAGCAGAAAGCACCCCCTGTTGTTGGGGGCTTCAATAGCAATGTGGGAAGTAAGGTGTTA
GGGCTCAAATATGAAGAAATTGACTGTCTCATAAATGATGAACACACAATTAAAGGGAGA
CGAGAGGGGAACGAAGTCTTTCTTCCATTCACTTGGGTTGAGAAATATTTTGATGTTTAT
GGAAAGGTGGTTCAGTATGATGGCTATGATCGGTTTGAATTCTCTCATAGCTATTCCAAA
GTCTATGCACAGAGAGCCCCCTATCACCCCGATGGTGTGTTTATGTCTTTTGAAGGCTAC
AATGTGGAAGTCCGAGACAGAGTCAAGTGCATAAGTGGGGTTGAAGGTGTGCCATTATCT
ACACAATGGGGACCTCAAGGCTATTTCTATCCAATCCAGATTGCACAGTATGGATTAAGT
CATTACAGCAAGAATCTAACTGAGAAACCTCCTCACATAGAGGTATATGAAACAGCAGAA
GACAGAGACAAAAACAAGCCTAATGACTGGACTGTGCCAAAGGGCTGCTTTATGGCGAAT
GTGGCTGATAAGTCTAGATTCACCAATGTCAAACAGTTTATTGCACCAGAAACCAGTGAA
GGTGTATCCTTGCAACTGGGAAACACAAAAGATTTTATTATTTCATTTGACCTCAAGTTC
TTGACAAATGGAAGTGTGTCCGTGGTTCTAGAGACCACAGAAAAGAATCAGCTCTTCACT
ATACATTATGTCTCAAATGCTCAGCTAATTGCTTTTAAAGAAAGAGATATATACTATGGC
ATTGGGCCCAGAACTTCATGGAGCACAGTTACCAGGGACCTGGTCACTGACCTCAGGAAA
GGAGTGGGTCTTTCAAACACAAAAGCTGTCAAGCCAACCAAAATAATGCCCAAGAAGGTG
GTTAGGTTGATTGCAAAAGGTAAGGGATTCCTCGACAACATTACCATCTCTACCACAGCC
CACATGGCTGCATTTTTTGCTGCTAGTGATTGGCTAGTAAGGAACCAGGATGAGAAAGGT
GGCTGGCCAATTATGGTGACCCGTAAGTTAGGGGAAGGGTTCAAGTCTTTAGAGCCAGGA
TGGTATTCTGCCATGGCCCAAGGGCAAGCCATTTCTACATTAGTCAGGGCCTATCTGTTA
ACAAAAGACCATATATTCCTCAATTCAGCTTTAAGGGCAACAGCCCCTTATAAGTTTCTA
TCTGAGCAGCATGGAGTTAAAGCTGTGTTTATGAATAAACATGACTGGTATGAAGAATAT
CCAACCACACCTAGCTCTTTTGTTTTAAATGGCTTTATGTATTCTTTAATTGGGCTGTAT
GACTTAAAAGAAACTGCAGGGGAAAAACTCGGAAAAGAAGCAAGGTCCTTGTATGAGCGT
GGCATGGAATCTCTTAAAGCCATGCTGCCCTTGTATGACACTGGCTCAGGAACCATCTAT
GACCTCCGTCACTTCATGCTTGGCATCGCTCCTAACCTGGCTCGCTGGGACTATCATACC
ACCCACATCAATCAGTTGCAGCTACTCAGTACCATTGATGAGTCCCCAGTCTTCAAAGAA
TTTGTCAAGAGGTGGAAAAGCTACCTTAAAGGCAGCAGGGCAAAGCACAACTAG
Protein Properties
Number of Residues 617
Molecular Weight 70100.5
Theoretical pI 9.32
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • 12-28
Protein Sequence
>D-glucuronyl C5-epimerase
MRCLAARVNYKTLIIICALFTLVTVLLWNKCSSDKAIQFPRRSSSGFRVDGFEKRAAASE
SNNYMNHVAKQQSEEAFPQEQQKAPPVVGGFNSNVGSKVLGLKYEEIDCLINDEHTIKGR
REGNEVFLPFTWVEKYFDVYGKVVQYDGYDRFEFSHSYSKVYAQRAPYHPDGVFMSFEGY
NVEVRDRVKCISGVEGVPLSTQWGPQGYFYPIQIAQYGLSHYSKNLTEKPPHIEVYETAE
DRDKNKPNDWTVPKGCFMANVADKSRFTNVKQFIAPETSEGVSLQLGNTKDFIISFDLKF
LTNGSVSVVLETTEKNQLFTIHYVSNAQLIAFKERDIYYGIGPRTSWSTVTRDLVTDLRK
GVGLSNTKAVKPTKIMPKKVVRLIAKGKGFLDNITISTTAHMAAFFAASDWLVRNQDEKG
GWPIMVTRKLGEGFKSLEPGWYSAMAQGQAISTLVRAYLLTKDHIFLNSALRATAPYKFL
SEQHGVKAVFMNKHDWYEEYPTTPSSFVLNGFMYSLIGLYDLKETAGEKLGKEARSLYER
GMESLKAMLPLYDTGSGTIYDLRHFMLGIAPNLARWDYHTTHINQLQLLSTIDESPVFKE
FVKRWKSYLKGSRAKHN
GenBank ID Protein 51317380
UniProtKB/Swiss-Prot ID O94923
UniProtKB/Swiss-Prot Entry Name GLCE_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_015554.1
GeneCard ID GLCE
GenAtlas ID GLCE
HGNC ID HGNC:17855
References
General References
  1. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218 ]
  2. Imami K, Sugiyama N, Kyono Y, Tomita M, Ishihama Y: Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column. Anal Sci. 2008 Jan;24(1):161-6. [PubMed:18187866 ]
  3. Zody MC, Garber M, Sharpe T, Young SK, Rowen L, O'Neill K, Whittaker CA, Kamal M, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Kodira CD, Madan A, Qin S, Yang X, Abbasi N, Abouelleil A, Arachchi HM, Baradarani L, Birditt B, Bloom S, Bloom T, Borowsky ML, Burke J, Butler J, Cook A, DeArellano K, DeCaprio D, Dorris L 3rd, Dors M, Eichler EE, Engels R, Fahey J, Fleetwood P, Friedman C, Gearin G, Hall JL, Hensley G, Johnson E, Jones C, Kamat A, Kaur A, Locke DP, Madan A, Munson G, Jaffe DB, Lui A, Macdonald P, Mauceli E, Naylor JW, Nesbitt R, Nicol R, O'Leary SB, Ratcliffe A, Rounsley S, She X, Sneddon KM, Stewart S, Sougnez C, Stone SM, Topham K, Vincent D, Wang S, Zimmer AR, Birren BW, Hood L, Lander ES, Nusbaum C: Analysis of the DNA sequence and duplication history of human chromosome 15. Nature. 2006 Mar 30;440(7084):671-5. [PubMed:16572171 ]
  4. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1998 Dec 31;5(6):355-64. [PubMed:10048485 ]