Hmdb loader

Showing Protein 14-3-3 protein gamma (HMDBP09172)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 2 metabolites
Identification
HMDB Protein ID HMDBP09172
Secondary Accession Numbers
  • 14929
Name 14-3-3 protein gamma
Synonyms
  1. 14-3-3 protein gamma, N-terminally processed
  2. KCIP-1
  3. Protein kinase C inhibitor protein 1
Gene Name YWHAG
Protein Type Enzyme
Biological Properties
General Function Involved in protein domain specific binding
Specific Function Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
protein binding
protein domain specific binding
Cellular Location
  1. Cytoplasm
Gene Properties
Chromosome Location Chromosome:7
Locus 7q11.23
SNPs YWHAG
Gene Sequence 
>744 bp
ATGGTGGACCGCGAGCAACTGGTGCAGAAAGCCCGGCTGGCCGAGCAGGCGGAGCGCTAC
GACGACATGGCCGCGGCCATGAAGAACGTGACAGAGCTGAATGAGCCACTGTCGAATGAG
GAACGAAACCTTCTGTCTGTGGCCTACAAGAACGTTGTGGGGGCACGCCGCTCTTCCTGG
AGGGTCATCAGTAGCATTGAGCAGAAGACATCTGCAGACGGCAATGAGAAGAAGATTGAG
ATGGTCCGTGCGTACCGGGAGAAGATAGAGAAGGAGTTGGAGGCTGTGTGCCAGGATGTG
CTGAGCCTGCTGGATAACTACCTGATCAAGAATTGCAGCGAGACCCAGTACGAGAGCAAA
GTGTTCTACCTGAAGATGAAAGGGGACTACTACCGCTACCTGGCTGAAGTGGCCACCGGA
GAGAAAAGGGCGACGGTGGTGGAGTCCTCCGAGAAGGCCTACAGCGAAGCCCACGAGATC
AGCAAAGAGCACATGCAGCCCACCCACCCCATCCGATTAGGCCTGGCTCTTAACTACTCC
GTCTTCTACTATGAGATCCAGAACGCCCCAGAGCAAGCGTGCCACTTGGCCAAGACCGCG
TTCGACGACGCCATCGCCGAGCTTGACACCCTCAACGAGGACTCCTACAAGGACTCCACG
CTCATCATGCAGCTCCTCCGCGACAACCTCACGCTCTGGACGAGCGACCAGCAGGACGAC
GATGGCGGCGAAGGCAACAATTAA
Protein Properties
Number of Residues 247
Molecular Weight 28302.3
Theoretical pI 4.52
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence 
>14-3-3 protein gamma
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
GenBank ID Protein 6016838
UniProtKB/Swiss-Prot ID P61981
UniProtKB/Swiss-Prot Entry Name 1433G_HUMAN
PDB IDs Not Available
GenBank Gene ID AB024334
GeneCard ID YWHAG
GenAtlas ID YWHAG
HGNC ID HGNC:12852
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. [PubMed:12665801 ]
  3. Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [PubMed:12853948 ]
  4. Yoshida K, Yamaguchi T, Natsume T, Kufe D, Miki Y: JNK phosphorylation of 14-3-3 proteins regulates nuclear targeting of c-Abl in the apoptotic response to DNA damage. Nat Cell Biol. 2005 Mar;7(3):278-85. [PubMed:15696159 ]
  5. Brummer T, Larance M, Herrera Abreu MT, Lyons RJ, Timpson P, Emmerich CH, Fleuren ED, Lehrbach GM, Schramek D, Guilhaus M, James DE, Daly RJ: Phosphorylation-dependent binding of 14-3-3 terminates signalling by the Gab2 docking protein. EMBO J. 2008 Sep 3;27(17):2305-16. [PubMed:19172738 ]
  6. Screaton RA, Conkright MD, Katoh Y, Best JL, Canettieri G, Jeffries S, Guzman E, Niessen S, Yates JR 3rd, Takemori H, Okamoto M, Montminy M: The CREB coactivator TORC2 functions as a calcium- and cAMP-sensitive coincidence detector. Cell. 2004 Oct 1;119(1):61-74. [PubMed:15454081 ]
  7. Nagata-Ohashi K, Ohta Y, Goto K, Chiba S, Mori R, Nishita M, Ohashi K, Kousaka K, Iwamatsu A, Niwa R, Uemura T, Mizuno K: A pathway of neuregulin-induced activation of cofilin-phosphatase Slingshot and cofilin in lamellipodia. J Cell Biol. 2004 May 24;165(4):465-71. [PubMed:15159416 ]
  8. Towbin H, Bair KW, DeCaprio JA, Eck MJ, Kim S, Kinder FR, Morollo A, Mueller DR, Schindler P, Song HK, van Oostrum J, Versace RW, Voshol H, Wood J, Zabludoff S, Phillips PE: Proteomics-based target identification: bengamides as a new class of methionine aminopeptidase inhibitors. J Biol Chem. 2003 Dec 26;278(52):52964-71. Epub 2003 Oct 8. [PubMed:14534293 ]
  9. Yang X, Lee WH, Sobott F, Papagrigoriou E, Robinson CV, Grossmann JG, Sundstrom M, Doyle DA, Elkins JM: Structural basis for protein-protein interactions in the 14-3-3 protein family. Proc Natl Acad Sci U S A. 2006 Nov 14;103(46):17237-42. Epub 2006 Nov 3. [PubMed:17085597 ]
  10. Autieri MV, Carbone CJ: 14-3-3Gamma interacts with and is phosphorylated by multiple protein kinase C isoforms in PDGF-stimulated human vascular smooth muscle cells. DNA Cell Biol. 1999 Jul;18(7):555-64. [PubMed:10433554 ]
  11. Horie M, Suzuki M, Takahashi E, Tanigami A: Cloning, expression, and chromosomal mapping of the human 14-3-3gamma gene (YWHAG) to 7q11.23. Genomics. 1999 Sep 1;60(2):241-3. [PubMed:10486217 ]