You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09180
Secondary Accession Numbers
  • 14937
Name Ferrochelatase
Synonyms Not Available
Gene Name DKFZp686P18130
Protein Type Enzyme
Biological Properties
General Function Involved in ferrochelatase activity
Specific Function Catalyzes the ferrous insertion into protoporphyrin IX
Pathways Not Available
Reactions Not Available
GO Classification
Function
catalytic activity
lyase activity
ferrochelatase activity
Process
metabolic process
nitrogen compound metabolic process
tetrapyrrole metabolic process
porphyrin metabolic process
heme biosynthetic process
porphyrin biosynthetic process
Cellular Location Not Available
Gene Properties
Chromosome Location Not Available
Locus Not Available
SNPs DKFZp686P18130
Gene Sequence
>1251 bp
ATGGCTGCGGCCCTGCGCGCCGCGGGCGTCCTGCTCCGCGATCCGCTGGCATCCAGCAGC
TGGAGGGTCTGTCAGCCATGGAGGTGGAAGTCAGGTGCAGCTGCAGCGGCCGTCACCACA
GAAACAGCCCAGCATGCCCAGGGTGCAAAACCTCAAGTTCAACCGCAGAAGAGGAAGCCG
AAAACTGGAATATTAATGCTAAACATGGGAGGCCCTGAAACTCTTGGAGATGTTCACGAC
TTCCTTCTGAGACTCTTCTTGGACCGAGACCTCATGACACTTCCTATTCAGAATAAGCTG
GCACCATTCATCGCCAAACGCCGAACCCCCAAGATTCAAGAGCAGTACCGCAGGATTGGA
GGCGGATCCCCCATCAAGATATGGACTTCCAAGCAGGGAGAGGGCATGGTAAAGCTGCTG
GATGAATTGTCCCCCAACACAGCCCCTCACAAATACTATATTGGATTTCGGTACGTCCAT
CCTTTAACAGAAGAAGCAATTGAAGAGATGGAGAGAGATGGCCTAGAAAGGGCTATTGCT
TTCACACAGTATCCACAGTACAGCTGCTCCACCACAGGCAGCAGCTTAAATGCCATTTAC
AGATACTATAATCAAGTGGGACGGAAGCCCACGATGAAGTGGAGCACTATTGACAGGTGG
CCCACACATCACCTCCTCATCCAGTGCTTTGCAGATCATATTCTAAAGGAACTGGACCAT
TTTCCACTTGAGAAGAGAAGCGAGGTGGTCATTCTGTTTTCTGCTCACTCACTGCCGATG
TCTGTGGTCAACAGAGGCGACCCATATCCTCAGGAGGTAAGCGCCACTGTCCAAAAAGTC
ATGGAAAGGCTGGAGTACTGCAACCCCTACCGACTGGTGTGGCAATCCAAGGTTGGTCCG
ATGCCCTGGTTGGGTCCTCAAACAGACGAATCTATCAAAGGGCTTTGTGAGAGGGGGAGG
AAGAATATCCTCTTGGTTCCGATAGCATTTACCAGTGACCATATTGAAACGCTGTATGAG
CTGGACATCGAGTACTCTCAAGTTTTAGCCAAGGAGTGTGGAGTTGAAAACATCAGAAGA
GCTGAGTCTCTTAATGGAAATCCATTGTTCTCTAAGGCCCTGGCCGACTTGGTGCATTCA
CACATCCAGTCAAACGAGCTGTGTTCCAAGCAGCTGACCCTGAGCTGTCCGCTCTGTGTC
AATCCTGTCTGCAGGGAGACTAAATCCTTCTTCACCAGCCAGCAGCTGTGA
Protein Properties
Number of Residues 416
Molecular Weight 47131.9
Theoretical pI 8.78
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ferrochelatase
MAAALRAAGVLLRDPLASSSWRVCQPWRWKSGAAAAAVTTETAQHAQGAKPQVQPQKRKP
KTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIG
GGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIA
FTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDH
FPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGP
MPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRR
AESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL
GenBank ID Protein 33096717
UniProtKB/Swiss-Prot ID Q7KZA3
UniProtKB/Swiss-Prot Entry Name Q7KZA3_HUMAN
PDB IDs
GenBank Gene ID BX571744
GeneCard ID DKFZp686P18130
GenAtlas ID DKFZp686P18130
HGNC ID HGNC:3647
References
General References Not Available