You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP09190
Secondary Accession Numbers
  • 14948
Name Fructosamine-3-kinase
Synonyms Not Available
Gene Name FN3K
Protein Type Enzyme
Biological Properties
General Function Carbohydrate transport and metabolism
Specific Function May initiate a process leading to the deglycation of fructoselysine and of glycated proteins. May play a role in the phosphorylation of 1-deoxy-1-morpholinofructose (DMF), fructoselysine, fructoseglycine, fructose and glycated lysozyme
Pathways Not Available
Reactions Not Available
GO Classification Not Available
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 17q25.3
SNPs FN3K
Gene Sequence
>930 bp
ATGGAGCAGCTGCTGCGCGCCGAGCTGCGCACCGCGACCCTGCGGGCCTTCGGCGGCCCC
GGCGCCGGCTGCATCAGCGAGGGCCGAGCCTACGACACGGACGCAGGCCCAGTGTTCGTC
AAAGTCAACCGCAGGACGCAGGCCCGGCAGATGTTTGAGGGGGAGGTGGCCAGCCTGGAG
GCCCTCCGGAGCACGGGCCTGGTGCGGGTGCCGAGGCCCATGAAGGTCATCGACCTGCCG
GGAGGTGGGGCCGCCTTTGTGATGGAGCATTTGAAGATGAAGAGCTTGAGCAGTCAAGCA
TCAAAACTTGGAGAGCAGATGGCAGATTTGCATCTTTACAACCAGAAGCTCAGGGAGAAG
TTGAAGGAGGAGGAGAACACAGTGGGCCGAAGAGGTGAGGGTGCTGAGCCTCAGTATGTG
GACAAGTTCGGCTTCCACACGGTGACGTGCTGCGGCTTCATCCCGCAGGTGAATGAGTGG
CAGGATGACTGGCCGACCTTTTTCGCCCGGCACCGGCTCCAGGCGCAGCTGGACCTCATT
GAGAAGGACTATGCTGACCGAGAGGCACGAGAACTCTGGTCCCGGCTACAGGTGAAGATC
CCGGATCTGTTTTGTGGCCTAGAGATTGTCCCCGCGTTGCTCCACGGGGATCTCTGGTCG
GGAAACGTGGCTGAGGACGACGTGGGGCCCATTATTTACGACCCGGCTTCCTTCTATGGC
CATTCCGAGTTTGAACTGGCAATCGCCTTGATGTTTGGGGGGTTCCCCAGATCCTTCTTC
ACCGCCTACCACCGGAAGATCCCCAAGGCTCCGGGCTTCGACCAGCGGCTGCTGCTCTAC
CAGCTGTTTAACTACCTGAACCACTGGAACCACTTCGGGCGGGAGTACAGGAGCCCTTCC
TTGGGCACCATGCGAAGGCTGCTCAAGTAG
Protein Properties
Number of Residues 309
Molecular Weight 35170.9
Theoretical pI 7.64
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Fructosamine-3-kinase
MEQLLRAELRTATLRAFGGPGAGCISEGRAYDTDAGPVFVKVNRRTQARQMFEGEVASLE
ALRSTGLVRVPRPMKVIDLPGGGAAFVMEHLKMKSLSSQASKLGEQMADLHLYNQKLREK
LKEEENTVGRRGEGAEPQYVDKFGFHTVTCCGFIPQVNEWQDDWPTFFARHRLQAQLDLI
EKDYADREARELWSRLQVKIPDLFCGLEIVPALLHGDLWSGNVAEDDVGPIIYDPASFYG
HSEFELAIALMFGGFPRSFFTAYHRKIPKAPGFDQRLLLYQLFNYLNHWNHFGREYRSPS
LGTMRRLLK
GenBank ID Protein 11191737
UniProtKB/Swiss-Prot ID Q9H479
UniProtKB/Swiss-Prot Entry Name FN3K_HUMAN
PDB IDs Not Available
GenBank Gene ID AJ404615
GeneCard ID FN3K
GenAtlas ID FN3K
HGNC ID HGNC:24822
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD: Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra. J Proteome Res. 2007 Nov;6(11):4150-62. Epub 2007 Oct 9. [PubMed:17924679 ]
  3. Delpierre G, Rider MH, Collard F, Stroobant V, Vanstapel F, Santos H, Van Schaftingen E: Identification, cloning, and heterologous expression of a mammalian fructosamine-3-kinase. Diabetes. 2000 Oct;49(10):1627-34. [PubMed:11016445 ]